Entry information : BdiPrx05 (Bradi1g17840)
Entry ID 7819
Creation 2011-01-07 (Toky Ramarohetra)
Last sequence changes 2011-01-07 (Toky Ramarohetra)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-08 (Qiang Li)
Peroxidase information: BdiPrx05 (Bradi1g17840)
Name (synonym) BdiPrx05 (Bradi1g17840)
Class Class III peroxidase    [Orthogroup: Prx046]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Brachypodium
Organism Brachypodium distachyon    [TaxId: 15368 ]
Cellular localisation N/D
Tissue type N/D
Inducer Abiotic stress
Repressor N/D
Best BLASTp hits
Perox score E-value BdiPrx05
start..stop
S start..stop
TmPrx02 506 0 1..317 1..316
TaPrx113-1B 503 0 1..317 1..316
AvePrx113-1B 503 0 1..317 1..316
HvPrx11 492 1e-177 5..317 2..315
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 14462626..14462838 213 N° 2 14463071..14463247 177 N° 3 14463390..14463953 564  
join(14462626..14462838,14463071..14463247,14463390..14463953)


exon

Literature and cross-references BdiPrx05 (Bradi1g17840)
Literature Lucas,S., Rokhsar,D., Wang,M., Lindquist,E.A., Fox,S.E., Vogel,J., Bragg,J.N., McKenzie,N., Bevan,M.W., Garvin,D., Michael,T., Hazen,S., Chang,J., Laudencia-Chingcuanco,D., Weng,Y. and Mockler,T. DOE Joint Genome Institute Brachypodium distachyon EST project. Unpublished (2009)
DNA ref. Phytozome 12:   Bd1 (14462626..14463953)
EST ref. GenBank:   GT772707.1 [3' end]   GT772708.1 [3' end]   GT779239.1 [3' end]   GT779240.1 [3' end]
Protein sequence: BdiPrx05 (Bradi1g17840)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   317 (293)
PWM (Da):   %s   32706.37 (30523.2) Transmb domain:   %s   i7-29o
PI (pH):   %s   7.66 (7.70) Peptide Signal:   %s   cut: 25 range:25-317
Sequence 358
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAASAASCISLLVLVVALAAVASAQLSPTFYDTSCPRAAATIKAAVVAAVRAEPRMGASLVRLHFHDCFVQGCDASILLAGQEQDAPPNKGSVRGYGVIENIKTQVEAICKQTVSCADIVTLAARDSVVALGGPSWTVPLGRRDSLDANVAQANSDLPGPTSSLNDLVTGFMKKNSLSLVDMVALSGAHTLGQAQCQNFRARIYGGDANINAAYATSLKANCPQTGGGDNNLAPLDPTTPNGFDNAYYANLMSQRGLLHSDQVLFNNGTADNTVRNFASSAAAFGSAFASAMIKMGNIEPKTGTQGQIRLVCSKVNS

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, intron 1 and 2), 4 ESTs. (cultivar: "Bd21").
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCCGCCTCTGCCGCATCTTGCATTTCGCTGCTGGTGCTCGTGGTGGCACTGGCCGCGGTGGCGTCGGCGCAGCTGTCGCCGACGTTCTACGACACGTCGTGCCCGAGGGCGGCGGCCA
CCATCAAGGCCGCCGTCGTGGCCGCCGTGAGGGCCGAGCCCCGCATGGGCGCGTCCCTGGTCCGCCTCCACTTCCACGACTGCTTCGTCCAG
GTATACACCTCCTCCTATTCTAAATTTT
TGTCGTGGTTTCAGTTCAAATTTGAACTAAAATTTAGGATCGGAGGGAGAGAGTAATTTCTAGACCATGAGGTACTTAAATTGTATGTACAAATATGCATGCGTATTTCTGGCTTAAAAG
CGACCTGCCAGCCGGGATTAGCCATGTATTCATGCATTATTGGCTTCTTAATTAATTGCTGCTGCTTGACTACTGTACATGAAGGGGTGTGACGCGTCGATTCTGCTGGCGGGCCAGGAG
CAGGACGCGCCCCCAAACAAGGGTTCAGTTCGAGGCTACGGCGTCATCGAAAACATCAAGACCCAGGTCGAGGCCATCTGCAAGCAGACCGTCTCCTGCGCCGACATCGTTACCCTCGCC
GCACGGGACTCCGTCGTCGCG
GTAATTAAGATCTATCTGATCATCTATATGATCAATTCAATTTCTACGACTTGTACTAAATCAACGACACTTATTATGGATCGGAATAAGTACTTACTT
AGTTAGCTAATTTCTGGCTTAATTGGCTTGGTTATACATGCAGTTGGGAGGGCCGTCATGGACAGTTCCACTAGGCAGAAGGGACTCCCTGGACGCAAACGTGGCGCAGGCGAACAGCGA
CCTCCCAGGCCCGACATCGAGCCTCAACGACCTGGTGACCGGGTTCATGAAGAAGAACAGCCTCAGCCTAGTCGACATGGTGGCGCTCTCCGGCGCGCACACGCTGGGGCAGGCCCAGTG
CCAGAACTTCAGGGCCCGGATCTACGGCGGCGACGCCAACATCAACGCGGCCTACGCCACGTCGCTCAAGGCCAACTGCCCGCAGACAGGCGGCGGGGACAACAACCTGGCGCCGCTGGA
CCCGACCACCCCCAACGGCTTCGACAACGCCTACTACGCCAACCTCATGAGCCAGAGGGGCCTCCTGCACTCGGACCAGGTGCTGTTCAACAATGGCACGGCGGACAACACGGTCCGGAA
CTTCGCGTCCAGCGCGGCGGCGTTCGGCAGCGCCTTCGCTTCGGCCATGATCAAGATGGGGAACATCGAGCCCAAGACCGGCACGCAGGGCCAGATCAGGCTCGTCTGCTCCAAGGTCAA
CTCTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCCGCCTCTGCCGCATCTTGCATTTCGCTGCTGGTGCTCGTGGTGGCACTGGCCGCGGTGGCGTCGGCGCAGCTGTCGCCGACGTTCTACGACACGTCGTGCCCGAGGGCGGCGGCCA
CCATCAAGGCCGCCGTCGTGGCCGCCGTGAGGGCCGAGCCCCGCATGGGCGCGTCCCTGGTCCGCCTCCACTTCCACGACTGCTTCGTCCAG
GGGTGTGACGCGTCGATTCTGCTGGCGG
GCCAGGAGCAGGACGCGCCCCCAAACAAGGGTTCAGTTCGAGGCTACGGCGTCATCGAAAACATCAAGACCCAGGTCGAGGCCATCTGCAAGCAGACCGTCTCCTGCGCCGACATCGTTA
CCCTCGCCGCACGGGACTCCGTCGTCGCG
TTGGGAGGGCCGTCATGGACAGTTCCACTAGGCAGAAGGGACTCCCTGGACGCAAACGTGGCGCAGGCGAACAGCGACCTCCCAGGCCCGA
CATCGAGCCTCAACGACCTGGTGACCGGGTTCATGAAGAAGAACAGCCTCAGCCTAGTCGACATGGTGGCGCTCTCCGGCGCGCACACGCTGGGGCAGGCCCAGTGCCAGAACTTCAGGG
CCCGGATCTACGGCGGCGACGCCAACATCAACGCGGCCTACGCCACGTCGCTCAAGGCCAACTGCCCGCAGACAGGCGGCGGGGACAACAACCTGGCGCCGCTGGACCCGACCACCCCCA
ACGGCTTCGACAACGCCTACTACGCCAACCTCATGAGCCAGAGGGGCCTCCTGCACTCGGACCAGGTGCTGTTCAACAATGGCACGGCGGACAACACGGTCCGGAACTTCGCGTCCAGCG
CGGCGGCGTTCGGCAGCGCCTTCGCTTCGGCCATGATCAAGATGGGGAACATCGAGCCCAAGACCGGCACGCAGGGCCAGATCAGGCTCGTCTGCTCCAAGGTCAACTCTTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGCCT CTGCCGCATC TTGCATTTCG CTGCTGGTGC TCGTGGTGGC ACTGGCCGCG GTGGCGTCGG CGCAGCTGTC GCCGACGTTC TACGACACGT CGTGCCCGAG GGCGGCGGCC  ACCATCAAGG CCGCCGTCGT GGCCGCCGTG AGGGCCGAGC CCCGCATGGG CGCGTCCCTG GTCCGCCTCC ACTTCCACGA CTGCTTCGTC CAGGGGTGTG ACGCGTCGAT TCTGCTGGCG  GGCCAGGAGC AGGACGCGCC CCCAAACAAG GGTTCAGTTC GAGGCTACGG CGTCATCGAA AACATCAAGA CCCAGGTCGA GGCCATCTGC AAGCAGACCG TCTCCTGCGC CGACATCGTT  ACCCTCGCCG CACGGGACTC CGTCGTCGCG TTGGGAGGGC CGTCATGGAC AGTTCCACTA GGCAGAAGGG ACTCCCTGGA CGCAAACGTG GCGCAGGCGA ACAGCGACCT CCCAGGCCCG  ACATCGAGCC TCAACGACCT GGTGACCGGG TTCATGAAGA AGAACAGCCT CAGCCTAGTC GACATGGTGG CGCTCTCCGG CGCGCACACG CTGGGGCAGG CCCAGTGCCA GAACTTCAGG  GCCCGGATCT ACGGCGGCGA CGCCAACATC AACGCGGCCT ACGCCACGTC GCTCAAGGCC AACTGCCCGC AGACAGGCGG CGGGGACAAC AACCTGGCGC CGCTGGACCC GACCACCCCC  AACGGCTTCG ACAACGCCTA CTACGCCAAC CTCATGAGCC AGAGGGGCCT CCTGCACTCG GACCAGGTGC TGTTCAACAA TGGCACGGCG GACAACACGG TCCGGAACTT CGCGTCCAGC  GCGGCGGCGT TCGGCAGCGC CTTCGCTTCG GCCATGATCA AGATGGGGAA CATCGAGCCC AAGACCGGCA CGCAGGGCCA GATCAGGCTC GTCTGCTCCA AGGTCAACTC TTAGGACGTC  GATCGTTCGT TGACATGCAG GTGAAGGAAT AAGGCTTATA GCACGTGGCC AGTATAGATA TACTCGATAC ACCAGCATGC ACTAGCTATA GTGTGTACAC ACGATCGAAT TCTCATGCAA 
AGGCATGGAG GATTCTTAAT TATTCTCTTT GTGTGATTTG TCTCAAGTCA ATCATGCAAT AAGTCTACAA TGAGTCTACA C 

Retrieve as FASTA