Entry information : BdiPrx31 (Bradi1g43680)
Entry ID 7825
Creation 2011-01-12 (Toky Ramarohetra)
Last sequence changes 2011-01-12 (Toky Ramarohetra)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-08 (Qiang Li)
Peroxidase information: BdiPrx31 (Bradi1g43680)
Name (synonym) BdiPrx31 (Bradi1g43680)
Class Class III peroxidase    [Orthogroup: Prx023]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Brachypodium
Organism Brachypodium distachyon    [TaxId: 15368 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BdiPrx31
start..stop
S start..stop
HvPrx16 646 0 1..334 1..334
FpPrx01 640 0 1..334 1..334
LpePrx01 637 0 1..334 1..334
OsPrx77 622 0 1..334 1..334
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 41489192..41489425 234 N° 2 41489539..41489730 192 N° 3 41490074..41490239 166 N° 4 41490563..41490975 413
join(41489192..41489425,41489539..41489730,41490074..41490239,41490563..41490975 )


exon

Literature and cross-references BdiPrx31 (Bradi1g43680)
DNA ref. Phytozome 12:   Bd1 (41489192..41490975)
Protein sequence: BdiPrx31 (Bradi1g43680)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   334 (307)
PWM (Da):   %s   36505.85 (33696.4) Transmb domain:   %s   i5-27o
PI (pH):   %s   4.55 (4.49) Peptide Signal:   %s   cut: 28 range:28-334
Sequence 375
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATGVLCSRAFALFMCCTLLAVPLLLAQDPLNLSLEHYSKTCPNVEHVVRTEMECAVRDEPRNAALMLRLHFHDCFVQGCDGSVLLDDTATMIGEKQADQNVNSLKGFEVVDKIKEKLEAECPGTVSCADLLAIAARDAVVLVGGPYWDVPVGRLDSKKASLDLANNDIPTAQQGLVTLISKFWEKGLDATDMVALVGSHTIGFARCANFRDRIYGDFEMTTKNSPVSATYLSKLKEICPLDGGDDNISAMDSHTSSTFDNAYFETLIKGEGLLNSDQEMWSSIAGYSTADTVNKYWADPELFFKQFSDSMVKMGNITNLEGGEVRKNCRFVNT

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, intron 1, 2 and 3), 4 ESTs. Strain="Bd21".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCTACAGGTGTGTTATGCTCCAGGGCGTTTGCTCTCTTCATGTGCTGCACTCTCCTGGCAGTGCCATTGCTGCTGGCTCAGGACCCGTTGAACCTGAGCCTAGAGCACTACTCGAAGA
CATGCCCTAATGTGGAGCATGTCGTCCGGACTGAGATGGAGTGCGCTGTGCGTGACGAACCACGCAACGCCGCATTGATGCTTCGCCTCCATTTCCATGACTGTTTCGTACAG
GTTGACT
ACCAAACGTTTTTTTGTACTTCACGTGCTAACCTAGTTTGCTAATCCACATTCATATTGAGGAGCAGGATTGAGTTTGCTCTAAACATCTAAATTTTCTGTTGCAGGGATGTGATGGATC
GGTGCTGCTTGATGACACGGCAACCATGATCGGAGAGAAGCAGGCAGACCAGAATGTGAACTCGTTGAAAGGATTTGAAGTGGTTGACAAGATCAAGGAGAAGCTGGAAGCTGAATGCCC
CGGAACAGTTTCCTGTGCAGACTTGCTTGCCATTGCAGCGAGGGACGCAGTTGTCTTG
GTAAATAGTATAACCTGACCTATAGTTCGGTGTTCCGATTCTTTGTGCAGTGGCTTACATAC
TTTTGCTTGCATCAGTTTCATGTCAGGCTTGGCATTTGAGGAATTAAGAATCTAGAAATAGATAGTCATTTTGAAATAACTTAGTATACCCTTAGAAATCCAAACAGCCATTTCATCATT
ACCTGATAAACTTGCTGAGCCTTCTGGATGCTGTTTGGCTACCTGCATCCTAGTATTCAGACTTGTATTAAACAAAGAACAGCATATATTCATTTCTTGAAACAAAGCAGTACAAATTCC
ATATGTACTCCGTATGTTACAACATGGAAAAAATATTTCAGGTCGGTGGGCCTTACTGGGATGTCCCAGTAGGAAGATTGGACTCCAAGAAGGCAAGTCTTGACCTTGCAAACAATGACA
TCCCCACCGCTCAGCAGGGTCTTGTCACCCTTATTTCCAAGTTCTGGGAGAAGGGCCTTGATGCCACTGACATGGTGGCCCTTGTCG
GTATGTTCTTCTCATTTGGCAGCTACAGTTTTA
CAGTAAAAAAGTCACTAGTTCAGTTCAGATTGACACAACCATAAAATTTCATCTGCTGTAAGCGATGTGAAATACTTCAACGATATGATAATGTTCAGATAGCCTACAGACACTCCTTCA
CTTTTTTTGGAGGGAGACACTCCTTTACAAGTGTGAAAAGTAACAACATGGAAATGTTATTTTTTAACCTGAACCTTCTGAATTCTGATGTGTGGGCATGTGGGAGTGCATCCTTATTAT
CTTTGTTAAGATAAACACTGCTTACCAGAAATATAACATTTGCATTGAAGGATCCCACACGATTGGTTTTGCCCGGTGCGCCAACTTCCGGGACAGAATATATGGCGACTTTGAGATGAC
AACCAAGAATAGCCCTGTTTCTGCAACCTACCTCAGCAAGCTGAAGGAAATCTGCCCCTTGGATGGTGGTGACGACAACATCAGTGCCATGGACAGCCATACTTCCTCGACCTTCGACAA
CGCCTACTTCGAGACCCTCATCAAGGGCGAGGGCCTCCTGAACTCTGACCAGGAGATGTGGTCAAGCATCGCCGGGTACTCCACAGCTGATACTGTCAACAAGTACTGGGCTGACCCAGA
GCTGTTTTTCAAGCAGTTCTCAGATTCCATGGTGAAGATGGGCAACATCACCAACCTTGAAGGCGGCGAGGTCAGGAAGAACTGCAGATTTGTGAACACATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCTACAGGTGTGTTATGCTCCAGGGCGTTTGCTCTCTTCATGTGCTGCACTCTCCTGGCAGTGCCATTGCTGCTGGCTCAGGACCCGTTGAACCTGAGCCTAGAGCACTACTCGAAGA
CATGCCCTAATGTGGAGCATGTCGTCCGGACTGAGATGGAGTGCGCTGTGCGTGACGAACCACGCAACGCCGCATTGATGCTTCGCCTCCATTTCCATGACTGTTTCGTACAG
GGATGTG
ATGGATCGGTGCTGCTTGATGACACGGCAACCATGATCGGAGAGAAGCAGGCAGACCAGAATGTGAACTCGTTGAAAGGATTTGAAGTGGTTGACAAGATCAAGGAGAAGCTGGAAGCTG
AATGCCCCGGAACAGTTTCCTGTGCAGACTTGCTTGCCATTGCAGCGAGGGACGCAGTTGTCTTG
GTCGGTGGGCCTTACTGGGATGTCCCAGTAGGAAGATTGGACTCCAAGAAGGCAA
GTCTTGACCTTGCAAACAATGACATCCCCACCGCTCAGCAGGGTCTTGTCACCCTTATTTCCAAGTTCTGGGAGAAGGGCCTTGATGCCACTGACATGGTGGCCCTTGTCG
GATCCCACA
CGATTGGTTTTGCCCGGTGCGCCAACTTCCGGGACAGAATATATGGCGACTTTGAGATGACAACCAAGAATAGCCCTGTTTCTGCAACCTACCTCAGCAAGCTGAAGGAAATCTGCCCCT
TGGATGGTGGTGACGACAACATCAGTGCCATGGACAGCCATACTTCCTCGACCTTCGACAACGCCTACTTCGAGACCCTCATCAAGGGCGAGGGCCTCCTGAACTCTGACCAGGAGATGT
GGTCAAGCATCGCCGGGTACTCCACAGCTGATACTGTCAACAAGTACTGGGCTGACCCAGAGCTGTTTTTCAAGCAGTTCTCAGATTCCATGGTGAAGATGGGCAACATCACCAACCTTG
AAGGCGGCGAGGTCAGGAAGAACTGCAGATTTGTGAACACATGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ACAAAAACAT CTGAACTGTC CAAAAAGAAA GGAACAGCTA AAACTAGGTC AGGATGGCTA CAGGTGTGTT ATGCTCCAGG GCGTTTGCTC TCTTCATGTG CTGCACTCTC CTGGCAGTGC  CATTGCTGCT GGCTCAGGAC CCGTTGAACC TGAGCCTAGA GCACTACTCG AAGACATGCC CTAATGTGGA GCATGTCGTC CGGACTGAGA TGGAGTGCGC TGTGCGTGAC GAACCACGCA  ACGCCGCATT GATGCTTCGC CTCCATTTCC ATGACTGTTT CGTACAGGGA TGTGATGGAT CGGTGCTGCT TGATGACACG GCAACCATGA TCGGAGAGAA GCAGGCAGAC CAGAATGTGA  ACTCGTTGAA AGGATTTGAA GTGGTTGACA AGATCAAGGA GAAGCTGGAA GCTGAATGCC CCGGAACAGT TTCCTGTGCA GACTTGCTTG CCATTGCAGC GAGGGACGCA GTTGTCTTGG  TCGGTGGGCC TTACTGGGAT GTCCCAGTAG GAAGATTGGA CTCCAAGAAG GCAAGTCTTG ACCTTGCAAA CAATGACATC CCCACCGCTC AGCAGGGTCT TGTCACCCTT ATTTCCAAGT  TCTGGGAGAA GGGCCTTGAT GCCACTGACA TGGTGGCCCT TGTCGGATCC CACACGATTG GTTTTGCCCG GTGCGCCAAC TTCCGGGACA GAATATATGG CGACTTTGAG ATGACAACCA  AGAATAGCCC TGTTTCTGCA ACCTACCTCA GCAAGCTGAA GGAAATCTGC CCCTTGGATG GTGGTGACGA CAACATCAGT GCCATGGACA GCCATACTTC CTCGACCTTC GACAACGCCT  ACTTCGAGAC CCTCATCAAG GGCGAGGGCC TCCTGAACTC TGACCAGGAG ATGTGGTCAA GCATCGCCGG GTACTCCACA GCTGATACTG TCAACAAGTA CTGGGCTGAC CCAGAGCTGT  TTTTCAAGCA GTTCTCAGAT TCCATGGTGA AGATGGGCAA CATCACCAAC CTTGAAGGCG GCGAGGTCAG GAAGAACTGC AGATTTGTGA ACACATGAGC CGAAGATTGA TAGTTGATGC  CTGTCTGAAA ATAAGAACGT ACTGGTCTGT TATAGGTATA TCGTCGTTGC ACTATAAAAA AATTGTTTGG CCATATCGCA TACTGCAGAT ATAATCATGT ATTTCAGAGT TTTGCACAAT  CTGTTATGTA AACGTCAGCA ATGGATTATG ATTAGTTTTT AGGATCTGTT TCAATCCGAA AATACAGCAA GAAAAGCAGA AGAAGAAACA AAAAATGTCA AGAGAACATG CTACAAGCCA 
AGCAATGCGA AACCTTATAG CTTCAAGAGA AGCTCCTTGT TG 

Retrieve as FASTA