Entry information : ZmPrx73(Zm00001d021533 / GRMZM2G010640)
Entry ID 783
Creation 2006-06-05 (Christophe Dunand)
Last sequence changes 2014-01-16 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2022-12-29 (Christophe Dunand)
Peroxidase information: ZmPrx73(Zm00001d021533 / GRMZM2G010640)
Name ZmPrx73(Zm00001d021533 / GRMZM2G010640)
Class Class III peroxidase    [Orthogroup: Prx038]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue type Roots
Inducer Drought
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrx73
start..stop
S start..stop
SbPrx33 533 0 1..364 1..361
SiPrx118 452 4.27e-160 1..365 1..358
TaPrx189-1B 387 7.79e-135 45..364 22..336
TaPrx189-1D 385 2.82e-134 45..364 22..336
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '783' 'complement(join(150019939..150020342,150020466..150020817,150020888..150021226))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 150020888..150021226 337 N° 2 150020466..150020817 350 N° 3 150019939..150020342 402  
complement(join(150019939..150020342,150020466..150020817,150020888..150021226))


exon

Literature and cross-references ZmPrx73(Zm00001d021533 / GRMZM2G010640)
Literature Bohnert,H. et al., unpublished
DNA ref. GenBank:   AC184048.4 (100141..101425)
EST ref. GenBank:   CF626044 [3' end]
Protein sequence: ZmPrx73(Zm00001d021533 / GRMZM2G010640)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   364 (338)
PWM (Da):   %s   39201.68 (36303.1) Transmb domain:   %s   i7-29o
PI (pH):   %s   8.24 (7.73) Peptide Signal:   %s   cut: 27 range:27-364
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRTPRGVSSSFLALYGFLLLVAVSVAATGYAASPGESSNGYGAAAGSNGGGQEGSYTVPPYQKSVDGLDERYYERSCPKMEEIVGTAVMKAVKADETLAASIIRLFFHDFAVGGVDGSVL
VDVPGQSEKYAEASRTLRGFELIEGIKKEVEAKCRATVSCADILTAAARDAAFSAGAPYWSLKYGRRDRKDYSSAEAADRDVPMGGQRVTELVAFFDTKGLNIQDLVALSGAHTIGRATC
GSVRPGLCKRRKARTLDRQYGDFLQRKCRAGGDAAEAYVELDGETPTAFDNQYYKNLLHGKGLLDTDQALLADSRTAGFVKSFAYQKPQEFAHQFAKSMRRLGEAQVLTGNEGEVRRKCS
AVNY*

Retrieve as FASTA  
Remarks Complete sequence from 1 EST and genomic (chromo 7, introns 1 and 3). Missing cystein residues. Containing motif FHDC.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGACGCCGCGGGGTGTCTCGTCGTCGTTCCTTGCCCTCTACGGGTTCCTTCTCCTCGTCGCCGTCTCGGTGGCCGCGACCGGCTACGCCGCTTCGCCGGGGGAGAGTTCCAACGGT
TACGGCGCTGCAGCCGGTTCGAACGGCGGCGGCCAGGAGGGAAGCTACACGGTGCCGCCGTACCAGAAGTCCGTGGACGGCCTCGACGAGCGGTACTACGAGAGGTCGTGCCCGAAAATG
GAGGAGATCGTCGGGACGGCCGTGATGAAGGCCGTGAAAGCCGACGAGACCCTCGCCGCCAGCATCATCCGCCTCTTCTTCCACGACTTCGCCGTCGGG
GTACGTACGTACGTGTGTATC
TTTCGTTGGTGGTCGGCGAATATAATTGACATGGTGGTGTGTGGTGCAGGGGGCGTGGACGGGTCGGTCCTGGTAGACGTGCCCGGGCAGAGCGAGAAGTACGCGGAGGCGAGCAGGACG
CTGCGCGGGTTCGAGCTGATCGAGGGGATCAAGAAGGAGGTGGAGGCCAAGTGCCGCGCCACCGTCTCCTGCGCCGACATCCTCACCGCCGCCGCTCGCGACGCCGCCTTCTCGGCCGGG
GCGCCCTACTGGTCGCTCAAGTACGGGCGCAGGGACAGGAAGGACTACTCCAGCGCCGAGGCGGCCGACCGCGACGTCCCCATGGGCGGCCAGCGCGTCACCGAGCTCGTCGCCTTCTTC
GATACGAAGGGTCTCAACATCCAAGACCTCGTCGCGCTTTCCG
GTGAGTCGTGAGTGCGAGAGCAATGCATATATCGATCGATCGATCGTTCGCGCGCGGACACACACACGCACACACAT
GCTTGTTAATGCTAACAGTGACGACATGCATGCACTATATATGCAGGAGAGCTCACACGATCGGGCGCGCGACGTGCGGATCCGTGAGGCCGGGGCTGTGCAAGCGCCGGAAGGCACGCA
CGCTGGACCGGCAGTACGGCGACTTCCTGCAGCGCAAGTGCCGCGCCGGCGGCGACGCGGCGGAGGCGTACGTGGAGCTGGACGGCGAGACGCCCACGGCGTTCGACAACCAGTACTACA
AGAACCTGCTGCACGGGAAGGGGCTGCTGGACACGGACCAGGCGCTGCTGGCGGACTCCCGGACGGCCGGGTTCGTCAAGTCGTTCGCGTACCAGAAGCCCCAGGAGTTCGCCCACCAGT
TCGCCAAGTCCATGCGCCGCCTCGGCGAGGCGCAGGTGCTCACCGGGAACGAGGGCGAGGTCCGCCGCAAGTGCTCGGCCGTCAACTACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGACGCCGCGGGGTGTCTCGTCGTCGTTCCTTGCCCTCTACGGGTTCCTTCTCCTCGTCGCCGTCTCGGTGGCCGCGACCGGCTACGCCGCTTCGCCGGGGGAGAGTTCCAACGGT
TACGGCGCTGCAGCCGGTTCGAACGGCGGCGGCCAGGAGGGAAGCTACACGGTGCCGCCGTACCAGAAGTCCGTGGACGGCCTCGACGAGCGGTACTACGAGAGGTCGTGCCCGAAAATG
GAGGAGATCGTCGGGACGGCCGTGATGAAGGCCGTGAAAGCCGACGAGACCCTCGCCGCCAGCATCATCCGCCTCTTCTTCCACGACTTCGCCGTCGGG
GGCGTGGACGGGTCGGTCCTG
GTAGACGTGCCCGGGCAGAGCGAGAAGTACGCGGAGGCGAGCAGGACGCTGCGCGGGTTCGAGCTGATCGAGGGGATCAAGAAGGAGGTGGAGGCCAAGTGCCGCGCCACCGTCTCCTGC
GCCGACATCCTCACCGCCGCCGCTCGCGACGCCGCCTTCTCGGCCGGGGCGCCCTACTGGTCGCTCAAGTACGGGCGCAGGGACAGGAAGGACTACTCCAGCGCCGAGGCGGCCGACCGC
GACGTCCCCATGGGCGGCCAGCGCGTCACCGAGCTCGTCGCCTTCTTCGATACGAAGGGTCTCAACATCCAAGACCTCGTCGCGCTTTCCG
GAGCTCACACGATCGGGCGCGCGACGTGC
GGATCCGTGAGGCCGGGGCTGTGCAAGCGCCGGAAGGCACGCACGCTGGACCGGCAGTACGGCGACTTCCTGCAGCGCAAGTGCCGCGCCGGCGGCGACGCGGCGGAGGCGTACGTGGAG
CTGGACGGCGAGACGCCCACGGCGTTCGACAACCAGTACTACAAGAACCTGCTGCACGGGAAGGGGCTGCTGGACACGGACCAGGCGCTGCTGGCGGACTCCCGGACGGCCGGGTTCGTC
AAGTCGTTCGCGTACCAGAAGCCCCAGGAGTTCGCCCACCAGTTCGCCAAGTCCATGCGCCGCCTCGGCGAGGCGCAGGTGCTCACCGGGAACGAGGGCGAGGTCCGCCGCAAGTGCTCG
GCCGTCAACTACTAA

Retrieve as FASTA