Entry information : BdiPrx14 (Bradi1g20010)
Entry ID 7833
Creation 2011-01-12 (Toky Ramarohetra)
Last sequence changes 2011-01-12 (Toky Ramarohetra)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-08 (Qiang Li)
Peroxidase information: BdiPrx14 (Bradi1g20010)
Name (synonym) BdiPrx14 (Bradi1g20010)
Class Class III peroxidase    [Orthogroup: Prx239]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Brachypodium
Organism Brachypodium distachyon    [TaxId: 15368 ]
Cellular localisation N/D
Tissue type Flowers
Inducer Drought
Repressor N/D
Best BLASTp hits
Perox score E-value BdiPrx14
start..stop
S start..stop
BdiPrx15 394 5.6e-138 1..346 1..346
TaPrx190-1D 390 3.49e-136 47..346 60..356
TaPrx190-3D 374 7.54e-130 47..346 46..342
TaPrx190-3B 364 4.67e-126 47..346 46..342
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '7833' 'complement(join(16007889..16008641,16008806..16009093))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 16008806..16009093 286 N° 2 16007889..16008641 751  
complement(join(16007889..16008641,16008806..16009093))


exon

Literature and cross-references BdiPrx14 (Bradi1g20010)
Literature Lucas,S., Rokhsar,D., Wang,M., Lindquist,E.A., Fox,S.E., Vogel,J., Bragg,J.N., McKenzie,N., Bevan,M.W., Garvin,D., Michael,T., Hazen,S., Chang,J., Laudencia-Chingcuanco,D., Weng,Y. and Mockler,T. DOE Joint Genome Institute Brachypodium distachyon EST project. Unpublished (2009)
DNA ref. Phytozome 12:   Bd1 (16009093..16007889)
EST ref. GenBank:   GT830228.1 [3' end]  GT830229.1 [3' end]
Protein sequence: BdiPrx14 (Bradi1g20010)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   346
PWM (Da):   %s   37695.03 Transmb domain:   %s   i7-29o
PI (pH):   %s   7.31
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGSEKQQIAGLAVVVAIALLGCACDASPLFHYPMVPRQSPAPGYSPLSEDYYKGKCYDHDVELIVKDVVYKALSEPYGRGIGAGLIRLFFHDCFVQGCDASVLLDPTPTNPEPEKHGIPN
RNSLRGFEVIDAIKKAVNEKCGNIVSCADILAFAARDATVFLSKERVGYFKMPAGRYDGKVSLASETIPNLPPPFANLETLKAMFKTKGLETDEMVTLSGAHSIGISRCSSFSDRINASS
PSDMEPGLANELRAKCNNQPSVTVDQDSVTPVDLDRQYYKNVLNKKVLFQSDAVLSSGETVGQVWLNANWPGLWESRFKAAMVKMGKIEVKTKDNGEIRKQCRSIN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, intron 1). 2 ESTs. Strain="Bd21".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGAAGTGAGAAGCAGCAAATTGCTGGCCTTGCTGTGGTGGTAGCAATAGCATTGCTTGGTTGCGCTTGCGATGCGAGCCCCCTGTTTCACTACCCGATGGTGCCCAGGCAAAGCCCG
GCTCCTGGCTATTCACCGCTCTCCGAGGACTACTACAAGGGCAAGTGCTACGACCACGACGTGGAACTTATCGTCAAAGACGTTGTGTACAAGGCGTTGAGCGAGCCTTACGGCCGCGGC
ATCGGCGCCGGCCTCATCCGCCTCTTCTTCCACGACTGCTTTGTCCAG
GTATATATGATAATACTTCATCCATGCAAATGTATGTTGCTATCGTTACATAATGATCATTTTTTTTAGAGT
AAAAGGGGTCAGGCCCCCGATTTCATTAACGAAATCAGATATGTTCCTAGGAGTTCAGTTACATGATGATCATTCATTTACTTTCCATTTAGGGGGTTGCGATGCGTCGGTGCTGTTGGA
CCCGACACCAACCAACCCGGAGCCCGAGAAGCATGGAATCCCCAACCGCAACAGCCTGCGCGGCTTCGAGGTGATCGATGCCATCAAGAAGGCGGTCAATGAAAAGTGTGGCAACATCGT
CTCGTGCGCCGACATCCTGGCCTTCGCTGCGCGCGATGCCACCGTCTTTCTAAGCAAAGAAAGGGTGGGCTACTTCAAGATGCCCGCCGGCCGTTACGACGGAAAAGTATCCCTCGCTAG
CGAGACCATCCCCAACCTGCCCCCGCCTTTCGCCAACCTCGAAACTCTCAAGGCCATGTTCAAGACCAAGGGGCTCGAGACCGATGAGATGGTAACCCTCTCCGGTGCCCACAGCATCGG
GATCTCCCGCTGCTCGTCCTTCAGCGACCGAATCAACGCCTCTAGCCCCTCGGACATGGAGCCCGGGTTAGCCAATGAGCTGAGAGCTAAATGCAACAACCAGCCTAGTGTCACGGTGGA
TCAGGATTCTGTGACTCCTGTGGACCTGGACAGACAGTACTACAAGAACGTCCTCAACAAGAAAGTGTTGTTCCAGTCAGACGCCGTGCTCTCATCGGGGGAGACCGTGGGCCAGGTGTG
GCTCAATGCCAATTGGCCGGGCCTGTGGGAATCTAGGTTCAAGGCAGCCATGGTGAAGATGGGCAAGATCGAGGTGAAGACCAAGGACAATGGGGAGATCAGAAAGCAGTGCAGGTCCAT
CAACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGAAGTGAGAAGCAGCAAATTGCTGGCCTTGCTGTGGTGGTAGCAATAGCATTGCTTGGTTGCGCTTGCGATGCGAGCCCCCTGTTTCACTACCCGATGGTGCCCAGGCAAAGCCCG
GCTCCTGGCTATTCACCGCTCTCCGAGGACTACTACAAGGGCAAGTGCTACGACCACGACGTGGAACTTATCGTCAAAGACGTTGTGTACAAGGCGTTGAGCGAGCCTTACGGCCGCGGC
ATCGGCGCCGGCCTCATCCGCCTCTTCTTCCACGACTGCTTTGTCCAG
GGTTGCGATGCGTCGGTGCTGTTGGACCCGACACCAACCAACCCGGAGCCCGAGAAGCATGGAATCCCCAAC
CGCAACAGCCTGCGCGGCTTCGAGGTGATCGATGCCATCAAGAAGGCGGTCAATGAAAAGTGTGGCAACATCGTCTCGTGCGCCGACATCCTGGCCTTCGCTGCGCGCGATGCCACCGTC
TTTCTAAGCAAAGAAAGGGTGGGCTACTTCAAGATGCCCGCCGGCCGTTACGACGGAAAAGTATCCCTCGCTAGCGAGACCATCCCCAACCTGCCCCCGCCTTTCGCCAACCTCGAAACT
CTCAAGGCCATGTTCAAGACCAAGGGGCTCGAGACCGATGAGATGGTAACCCTCTCCGGTGCCCACAGCATCGGGATCTCCCGCTGCTCGTCCTTCAGCGACCGAATCAACGCCTCTAGC
CCCTCGGACATGGAGCCCGGGTTAGCCAATGAGCTGAGAGCTAAATGCAACAACCAGCCTAGTGTCACGGTGGATCAGGATTCTGTGACTCCTGTGGACCTGGACAGACAGTACTACAAG
AACGTCCTCAACAAGAAAGTGTTGTTCCAGTCAGACGCCGTGCTCTCATCGGGGGAGACCGTGGGCCAGGTGTGGCTCAATGCCAATTGGCCGGGCCTGTGGGAATCTAGGTTCAAGGCA
GCCATGGTGAAGATGGGCAAGATCGAGGTGAAGACCAAGGACAATGGGGAGATCAGAAAGCAGTGCAGGTCCATCAACTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTTCTCA GAAGCTGGTT ATCTTAACTA AGCTTAGCTA GATATAAATA GAGCTGCACA GGACCAAGTT TTCTTCACTC ACTCACCATC AGCTGCTTCT CTCGAGCTTA GTACTAGCAA  CAACCAGCCA TGGGAAGTGA GAAGCAGCAA ATTGCTGGCC TTGCTGTGGT GGTAGCAATA GCATTGCTTG GTTGCGCTTG CGATGCGAGC CCCCTGTTTC ACTACCCGAT GGTGCCCAGG  CAAAGCCCGG CTCCTGGCTA TTCACCGCTC TCCGAGGACT ACTACAAGGG CAAGTGCTAC GACCACGACG TGGAACTTAT CGTCAAAGAC GTTGTGTACA AGGCGTTGAG CGAGCCTTAC  GGCCGCGGCA TCGGCGCCGG CCTCATCCGC CTCTTCTTCC ACGACTGCTT TGTCCAGGGT TGCGATGCGT CGGTGCTGTT GGACCCGACA CCAACCAACC CGGAGCCCGA GAAGCATGGA  ATCCCCAACC GCAACAGCCT GCGCGGCTTC GAGGTGATCG ATGCCATCAA GAAGGCGGTC AATGAAAAGT GTGGCAACAT CGTCTCGTGC GCCGACATCC TGGCCTTCGC TGCGCGCGAT  GCCACCGTCT TTCTAAGCAA AGAAAGGGTG GGCTACTTCA AGATGCCCGC CGGCCGTTAC GACGGAAAAG TATCCCTCGC TAGCGAGACC ATCCCCAACC TGCCCCCGCC TTTCGCCAAC  CTCGAAACTC TCAAGGCCAT GTTCAAGACC AAGGGGCTCG AGACCGATGA GATGGTAACC CTCTCCGGTG CCCACAGCAT CGGGATCTCC CGCTGCTCGT CCTTCAGCGA CCGAATCAAC  GCCTCTAGCC CCTCGGACAT GGAGCCCGGG TTAGCCAATG AGCTGAGAGC TAAATGCAAC AACCAGCCTA GTGTCACGGT GGATCAGGAT TCTGTGACTC CTGTGGACCT GGACAGACAG  TACTACAAGA ACGTCCTCAA CAAGAAAGTG TTGTTCCAGT CAGACGCCGT GCTCTCATCG GGGGAGACCG TGGGCCAGGT GTGGCTCAAT GCCAATTGGC CGGGCCTGTG GGAATCTAGG  TTCAAGGCAG CCATGGTGAA GATGGGCAAG ATCGAGGTGA AGACCAAGGA CAATGGGGAG ATCAGAAAGC AGTGCAGGTC CATCAACTAG TAGTGCTGAT CCAATGACCG CAACAATGCC  AGAAAGATCT GAATAAGCTC GTGCTTTTTT GCCTTCTGCT ATTTTGGAAT TTCAATTAAT CGTTGTTGAA TTATTACTGT ACGTACTATT TCTTTTCCAC GTACTAAGGT TTTTGTTCAG 
TCTTGAATTA CATTTGATTG ATTGTACCAA AACAGTTATT GGTGTACGTA CTTCATATCA ATTAATTAAT GAGATGATAT TTTTTGTTTG TTTAATATAC 

Retrieve as FASTA