Entry information : BdiPrx14 (Bradi1g20010)
Entry ID 7833
Creation 2011-01-12 (Toky Ramarohetra)
Last sequence changes 2011-01-12 (Toky Ramarohetra)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-08 (Qiang Li)
Peroxidase information: BdiPrx14 (Bradi1g20010)
Name (synonym) BdiPrx14 (Bradi1g20010)
Class Class III peroxidase    [Orthogroup: Prx239]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Brachypodium
Organism Brachypodium distachyon    [TaxId: 15368 ]
Cellular localisation N/D
Tissue type Flowers
Inducer Drought
Repressor N/D
Best BLASTp hits
Perox score E-value BdiPrx14
start..stop
S start..stop
BdiPrx15 394 5.62e-138 1..346 1..346
TaPrx190-1D 390 3.5e-136 47..346 60..356
TaPrx190-3D 374 7.56e-130 47..346 46..342
TaPrx190-3B 364 4.68e-126 47..346 46..342
Gene structure Fichier Exons


exon

Literature and cross-references BdiPrx14 (Bradi1g20010)
Literature Lucas,S., Rokhsar,D., Wang,M., Lindquist,E.A., Fox,S.E., Vogel,J., Bragg,J.N., McKenzie,N., Bevan,M.W., Garvin,D., Michael,T., Hazen,S., Chang,J., Laudencia-Chingcuanco,D., Weng,Y. and Mockler,T. DOE Joint Genome Institute Brachypodium distachyon EST project. Unpublished (2009)
DNA ref. Phytozome 12:   Bd1 (16009093..16007889)
EST ref. GenBank:   GT830228.1 [3' end]  GT830229.1 [3' end]
Protein sequence: BdiPrx14 (Bradi1g20010)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   346
PWM (Da):   %s   37695.03 Transmb domain:   %s   i7-29o
PI (pH):   %s   7.31
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGSEKQQIAGLAVVVAIALLGCACDASPLFHYPMVPRQSPAPGYSPLSEDYYKGKCYDHDVELIVKDVVYKALSEPYGRGIGAGLIRLFFHDCFVQGCDASVLLDPTPTNPEPEKHGIPN
RNSLRGFEVIDAIKKAVNEKCGNIVSCADILAFAARDATVFLSKERVGYFKMPAGRYDGKVSLASETIPNLPPPFANLETLKAMFKTKGLETDEMVTLSGAHSIGISRCSSFSDRINASS
PSDMEPGLANELRAKCNNQPSVTVDQDSVTPVDLDRQYYKNVLNKKVLFQSDAVLSSGETVGQVWLNANWPGLWESRFKAAMVKMGKIEVKTKDNGEIRKQCRSIN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, intron 1). 2 ESTs. Strain="Bd21".
DNA
Send to BLAST
CDS
Send to BLAST
cDNA
Send to BLAST