Entry information : BdiPrx29 (Bradi1g41900)
Entry ID 7838
Creation 2011-01-12 (Toky Ramarohetra)
Last sequence changes 2011-01-12 (Toky Ramarohetra)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-08 (Qiang Li)
Peroxidase information: BdiPrx29 (Bradi1g41900)
Name (synonym) BdiPrx29 (Bradi1g41900)
Class Class III peroxidase    [Orthogroup: Prx104]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Brachypodium
Organism Brachypodium distachyon    [TaxId: 15368 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BdiPrx29
start..stop
S start..stop
TaPrx111-1B 558 0 1..371 1..372
TaPrx111-1D 551 0 30..371 28..367
TaPrx111-1A 549 0 30..371 33..372
OsPrx79 481 8.07e-171 1..370 17..390
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '7838' 'complement(join(38615082..38615978,38616066..38616290))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 38616066..38616290 223 N° 2 38615082..38615978 895  
complement(join(38615082..38615978,38616066..38616290))


exon

Literature and cross-references BdiPrx29 (Bradi1g41900)
DNA ref. Phytozome 12:   Bd1 (38616290..38615082)
Protein sequence: BdiPrx29 (Bradi1g41900)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   373 (349)
PWM (Da):   %s   41378.73 (38762.3)  
PI (pH):   %s   6.42 (6.25) Peptide Signal:   %s   cut: 25 range:25-373
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MARLTVAMLFFVLALALAPRNMDAVVVESLQPGFYNQSCPEVEQV
VRDVVDSEVGMDHTLAPGLIRIFFHDCFIT
GCDASILLDESPAGDVPEKQSSANGFTLHGLRTIDIAKSTLEAMCPRTVSCSDIVAFAARDAAVAAGLPTYEVAAGRRDGEHSRMDDLPGNFPVPGHTVPRLTELFQKRGLSQEDLVVLS
GAHSIGGAHCFMFSNRIYGFSKTADIDPSLDPAFAKLLREMCPRPKPDDNPEEAPKIDFDQRTAQKLDNSYYNELLARRSLLTSDSALVQDPATRPIVESFAKDDALWQKKFGEAMQKVG
KLDVLTRPEEGQIRRNCRMVNRPKSEMRTHMGRISWPKPRHPMLQMMNWFIRGFQQPA*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, intron 1), no EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGCGGTTGACGGTGGCGATGCTGTTCTTTGTGCTGGCGCTGGCCCTGGCCCCACGCAACATGGACGCGGTCGTCGTGGAAAGCCTGCAGCCGGGGTTCTACAACCAGTCATGCCCG
GAGGTGGAGCAGGTCGTCCGCGACGTCGTCGACTCCGAGGTCGGCATGGACCACACCCTCGCCCCCGGCCTCATCCGCATCTTCTTCCACGACTGCTTCATCACG
GTATGTATTTATTCA
TCGGAATGAAATACATTTATGCAATGCAGGATCGATGTATATATATCGGTTGGTTGATATGTGTGCGCGCAGGGGGCTGCGACGCATCCATCCTGCTGGACGAGTCGCCGGCGGGCGACG
TACCGGAGAAGCAGTCGTCGGCCAACGGCTTCACCCTGCACGGGCTCCGGACCATCGACATCGCCAAGTCGACCCTCGAGGCCATGTGCCCGCGCACCGTGTCCTGCTCCGACATCGTGG
CCTTCGCCGCCCGCGATGCCGCCGTGGCGGCGGGCCTCCCGACCTACGAGGTCGCCGCGGGCCGCCGCGACGGGGAGCACTCGAGGATGGACGACCTCCCGGGCAACTTCCCCGTGCCAG
GCCACACGGTGCCCCGGCTCACGGAGCTCTTCCAGAAGCGTGGCCTGTCCCAGGAGGACCTGGTGGTGCTCTCGGGCGCGCACTCCATCGGGGGCGCGCACTGCTTCATGTTCTCCAACC
GCATCTACGGCTTCTCCAAGACCGCCGACATCGACCCGTCGCTGGACCCGGCCTTCGCCAAGCTTCTCCGGGAGATGTGCCCGCGGCCCAAGCCCGACGACAACCCGGAGGAGGCCCCCA
AGATCGACTTCGACCAGCGGACGGCCCAGAAGCTCGACAACTCCTACTACAACGAGCTGCTGGCCCGGCGCAGCCTGCTCACCTCCGACAGCGCGCTCGTCCAGGACCCGGCGACGAGGC
CCATCGTGGAGAGCTTCGCCAAGGACGACGCCCTGTGGCAGAAGAAGTTCGGCGAGGCGATGCAGAAGGTGGGCAAGCTCGACGTGCTCACCCGCCCCGAGGAGGGCCAGATCAGGAGGA
ATTGCCGGATGGTCAACAGGCCCAAGAGCGAGATGAGGACACACATGGGCAGGATTTCATGGCCCAAGCCCCGGCACCCCATGCTCCAGATGATGAACTGGTTCATCCGTGGCTTCCAGC
AGCCAGCCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGCGGTTGACGGTGGCGATGCTGTTCTTTGTGCTGGCGCTGGCCCTGGCCCCACGCAACATGGACGCGGTCGTCGTGGAAAGCCTGCAGCCGGGGTTCTACAACCAGTCATGCCCG
GAGGTGGAGCAGGTCGTCCGCGACGTCGTCGACTCCGAGGTCGGCATGGACCACACCCTCGCCCCCGGCCTCATCCGCATCTTCTTCCACGACTGCTTCATCACG
GGCTGCGACGCATCC
ATCCTGCTGGACGAGTCGCCGGCGGGCGACGTACCGGAGAAGCAGTCGTCGGCCAACGGCTTCACCCTGCACGGGCTCCGGACCATCGACATCGCCAAGTCGACCCTCGAGGCCATGTGC
CCGCGCACCGTGTCCTGCTCCGACATCGTGGCCTTCGCCGCCCGCGATGCCGCCGTGGCGGCGGGCCTCCCGACCTACGAGGTCGCCGCGGGCCGCCGCGACGGGGAGCACTCGAGGATG
GACGACCTCCCGGGCAACTTCCCCGTGCCAGGCCACACGGTGCCCCGGCTCACGGAGCTCTTCCAGAAGCGTGGCCTGTCCCAGGAGGACCTGGTGGTGCTCTCGGGCGCGCACTCCATC
GGGGGCGCGCACTGCTTCATGTTCTCCAACCGCATCTACGGCTTCTCCAAGACCGCCGACATCGACCCGTCGCTGGACCCGGCCTTCGCCAAGCTTCTCCGGGAGATGTGCCCGCGGCCC
AAGCCCGACGACAACCCGGAGGAGGCCCCCAAGATCGACTTCGACCAGCGGACGGCCCAGAAGCTCGACAACTCCTACTACAACGAGCTGCTGGCCCGGCGCAGCCTGCTCACCTCCGAC
AGCGCGCTCGTCCAGGACCCGGCGACGAGGCCCATCGTGGAGAGCTTCGCCAAGGACGACGCCCTGTGGCAGAAGAAGTTCGGCGAGGCGATGCAGAAGGTGGGCAAGCTCGACGTGCTC
ACCCGCCCCGAGGAGGGCCAGATCAGGAGGAATTGCCGGATGGTCAACAGGCCCAAGAGCGAGATGAGGACACACATGGGCAGGATTTCATGGCCCAAGCCCCGGCACCCCATGCTCCAG
ATGATGAACTGGTTCATCCGTGGCTTCCAGCAGCCAGCCTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGCGGT TGACGGTGGC GATGCTGTTC TTTGTGCTGG CGCTGGCCCT GGCCCCACGC AACATGGACG CGGTCGTCGT GGAAAGCCTG CAGCCGGGGT TCTACAACCA GTCATGCCCG  GAGGTGGAGC AGGTCGTCCG CGACGTCGTC GACTCCGAGG TCGGCATGGA CCACACCCTC GCCCCCGGCC TCATCCGCAT CTTCTTCCAC GACTGCTTCA TCACGGGCTG CGACGCATCC  ATCCTGCTGG ACGAGTCGCC GGCGGGCGAC GTACCGGAGA AGCAGTCGTC GGCCAACGGC TTCACCCTGC ACGGGCTCCG GACCATCGAC ATCGCCAAGT CGACCCTCGA GGCCATGTGC  CCGCGCACCG TGTCCTGCTC CGACATCGTG GCCTTCGCCG CCCGCGATGC CGCCGTGGCG GCGGGCCTCC CGACCTACGA GGTCGCCGCG GGCCGCCGCG ACGGGGAGCA CTCGAGGATG  GACGACCTCC CGGGCAACTT CCCCGTGCCA GGCCACACGG TGCCCCGGCT CACGGAGCTC TTCCAGAAGC GTGGCCTGTC CCAGGAGGAC CTGGTGGTGC TCTCGGGCGC GCACTCCATC  GGGGGCGCGC ACTGCTTCAT GTTCTCCAAC CGCATCTACG GCTTCTCCAA GACCGCCGAC ATCGACCCGT CGCTGGACCC GGCCTTCGCC AAGCTTCTCC GGGAGATGTG CCCGCGGCCC  AAGCCCGACG ACAACCCGGA GGAGGCCCCC AAGATCGACT TCGACCAGCG GACGGCCCAG AAGCTCGACA ACTCCTACTA CAACGAGCTG CTGGCCCGGC GCAGCCTGCT CACCTCCGAC  AGCGCGCTCG TCCAGGACCC GGCGACGAGG CCCATCGTGG AGAGCTTCGC CAAGGACGAC GCCCTGTGGC AGAAGAAGTT CGGCGAGGCG ATGCAGAAGG TGGGCAAGCT CGACGTGCTC  ACCCGCCCCG AGGAGGGCCA GATCAGGAGG AATTGCCGGA TGGTCAACAG GCCCAAGAGC GAGATGAGGA CACACATGGG CAGGATTTCA TGGCCCAAGC CCCGGCACCC CATGCTCCAG  ATGATGAACT GGTTCATCCG TGGCTTCCAG CAGCCAGCCT GATCCAGCAG TGATCACTAC TCATCAGGCC GTTCGCCAAC GTATATAGTT GTGTGGAGAT TTTTCGCAGC TGTCTGCCGT 
TTGGTCGTTG CGTTAATTTT TCTTCTTTTC CCCTTCAGTC TAACG 

Retrieve as FASTA