Entry information : BdiPrx46 (Bradi1g68900)
Entry ID 7841
Creation 2011-01-12 (Toky Ramarohetra)
Last sequence changes 2011-01-12 (Toky Ramarohetra)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-08 (Qiang Li)
Peroxidase information: BdiPrx46 (Bradi1g68900)
Name (synonym) BdiPrx46 (Bradi1g68900)
Class Class III peroxidase    [Orthogroup: Prx005]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Brachypodium
Organism Brachypodium distachyon    [TaxId: 15368 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BdiPrx46
start..stop
S start..stop
OsPrx39 517 0 26..331 28..333
ZmPrx25 512 0 6..331 14..336
SiPrx145 511 0 7..331 19..340
SbPrx20 508 0 6..331 15..337
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 67352566..67352781 216 N° 2 67352904..67353095 192 N° 3 67353528..67353693 166 N° 4 67353781..67354202 422
join(67352566..67352781,67352904..67353095,67353528..67353693,67353781..67354202 )


exon

Literature and cross-references BdiPrx46 (Bradi1g68900)
DNA ref. Phytozome 12:   Bd1 (67352566..67354202)
Protein sequence: BdiPrx46 (Bradi1g68900)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   331 (306)
PWM (Da):   %s   35580.24 (33237.9)  
PI (pH):   %s   9.31 (9.31) Peptide Signal:   %s   cut: 26 range:26-331
Sequence 372
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MQAIRAVLLGIAVVLGLGGVPGGEAQLDEKFYDGSCPGVHRIVRRVLKEAHQADVRIYASLTRLHFHDCFVQGCDGSILLDNSTSIVSEKFAKPNNNSVRGYTVVDAVKAALEEACPGVVSCADILAVAAKISVELSGGPRWRVPLGRRDGTTANLTAANHVLPSPRDNITMLQRKFRAVGLDDTDLVALSGAHTFGRAQCQFVTDRLYNFSKTGKPDPTMDAGYRVQLARSCPRRHGNRTALRDLDPATPDAFDKSYFTNLQASRGFLQSDQELLLAPGAPTAAIVARFAGSEKAFFRSFASSMVNMGNIRPLTGGQGEVRKNCWKVNGS

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, intron 1, 2 and 3), no EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGCAGGCAATTCGTGCCGTCCTTCTGGGCATCGCCGTCGTGCTCGGCCTGGGCGGCGTCCCCGGCGGCGAGGCGCAGCTGGACGAGAAGTTCTACGACGGCTCGTGCCCGGGCGTGCACA
GGATCGTGCGGCGGGTGCTGAAGGAGGCGCACCAGGCCGACGTGCGCATCTACGCCAGCCTCACCCGCCTCCACTTCCACGACTGCTTCGTCCAG
GCAATGCTCAAAACCAGAGTGCTGC
AGTGCAGCCTGCCGCCAACCTTGATGAATTTCGGCGTCCACATTTGCCGCGACGCTGACACTAGATTCCGTACGTGTTTCCGTCGTGTGTGTCTCAGGGATGCGACGGGTCGATCCTGCT
GGACAACAGCACGAGCATCGTGTCGGAGAAGTTCGCGAAGCCGAACAACAACTCGGTGCGGGGGTACACGGTGGTGGACGCCGTCAAGGCGGCGCTGGAGGAGGCCTGCCCCGGCGTCGT
CTCCTGCGCCGACATCCTCGCCGTCGCCGCCAAGATCTCTGTCGAACTG
GTACGCACGCTAGCTCATCGATCGGAAGTTCCGTGCTTAGCATACAACTTTTCACGCGCGCACCGTGGCAA
TCAATTAAGCTTCCAGCAACGTGCATGCGGTAGCTAGCTACAGCCTGATCGAGCCTACTACATATGCCCGAGCCTGCAGCAATAATTTGGAAACCGTCGGTGCAAAATAATTCAGCATGC
CTGGAGAGATCCATCCATCGCCTGATTTCTTAGAGCACAGAACCTAGTACGAGTACGAAGTGGATATTCAGGCGTCACGTCGTGTCGGGCATCGGTCGATCGGCACCACCAGATATGTCG
TATCACACCAAACCCACCTTTCCGTGTGGCGGCCGGCAGGCACTTTAATCCAACACGGGCACATGCATCATCAACTTTACACATCTCACTGGTCTCACATGCATGTTTGTACGCAATGCA
GTCCGGAGGCCCCCGGTGGCGCGTCCCGCTGGGCCGGCGCGACGGCACCACGGCCAACCTCACGGCCGCGAACCACGTCCTCCCGAGCCCGCGCGACAACATCACCATGCTCCAGCGCAA
GTTCCGCGCCGTGGGCCTCGACGACACCGACCTCGTCGCCCTCTCAG
GTAAACAACCCAACTCAACACCCGATCGAGATATTGGAACACAGAGAAAAAACGGCGCCCTTGACAAAATTAC
TCTGTGAACTCCAGGGGCGCACACGTTCGGGCGGGCGCAGTGCCAGTTCGTGACGGACAGGCTCTACAACTTCAGCAAGACGGGGAAGCCGGACCCGACCATGGACGCGGGCTACCGGGT
GCAGCTGGCCAGGAGCTGCCCGCGGCGGCACGGGAACAGGACGGCGCTCCGCGACCTCGACCCGGCCACGCCCGACGCCTTCGACAAGAGCTACTTCACCAACCTCCAGGCCAGCCGCGG
GTTCCTCCAGTCCGACCAGGAGCTGTTGTTGGCGCCCGGCGCGCCCACGGCGGCCATCGTCGCCCGCTTCGCCGGCAGCGAGAAGGCCTTCTTCAGGAGCTTCGCTTCGTCCATGGTCAA
CATGGGGAACATCAGGCCGCTCACGGGTGGCCAGGGAGAGGTCCGGAAGAATTGCTGGAAGGTTAATGGAAGCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGCAGGCAATTCGTGCCGTCCTTCTGGGCATCGCCGTCGTGCTCGGCCTGGGCGGCGTCCCCGGCGGCGAGGCGCAGCTGGACGAGAAGTTCTACGACGGCTCGTGCCCGGGCGTGCACA
GGATCGTGCGGCGGGTGCTGAAGGAGGCGCACCAGGCCGACGTGCGCATCTACGCCAGCCTCACCCGCCTCCACTTCCACGACTGCTTCGTCCAG
GGATGCGACGGGTCGATCCTGCTGG
ACAACAGCACGAGCATCGTGTCGGAGAAGTTCGCGAAGCCGAACAACAACTCGGTGCGGGGGTACACGGTGGTGGACGCCGTCAAGGCGGCGCTGGAGGAGGCCTGCCCCGGCGTCGTCT
CCTGCGCCGACATCCTCGCCGTCGCCGCCAAGATCTCTGTCGAACTG
TCCGGAGGCCCCCGGTGGCGCGTCCCGCTGGGCCGGCGCGACGGCACCACGGCCAACCTCACGGCCGCGAACC
ACGTCCTCCCGAGCCCGCGCGACAACATCACCATGCTCCAGCGCAAGTTCCGCGCCGTGGGCCTCGACGACACCGACCTCGTCGCCCTCTCAG
GGGCGCACACGTTCGGGCGGGCGCAGT
GCCAGTTCGTGACGGACAGGCTCTACAACTTCAGCAAGACGGGGAAGCCGGACCCGACCATGGACGCGGGCTACCGGGTGCAGCTGGCCAGGAGCTGCCCGCGGCGGCACGGGAACAGGA
CGGCGCTCCGCGACCTCGACCCGGCCACGCCCGACGCCTTCGACAAGAGCTACTTCACCAACCTCCAGGCCAGCCGCGGGTTCCTCCAGTCCGACCAGGAGCTGTTGTTGGCGCCCGGCG
CGCCCACGGCGGCCATCGTCGCCCGCTTCGCCGGCAGCGAGAAGGCCTTCTTCAGGAGCTTCGCTTCGTCCATGGTCAACATGGGGAACATCAGGCCGCTCACGGGTGGCCAGGGAGAGG
TCCGGAAGAATTGCTGGAAGGTTAATGGAAGCTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCAGGCAA TTCGTGCCGT CCTTCTGGGC ATCGCCGTCG TGCTCGGCCT GGGCGGCGTC CCCGGCGGCG AGGCGCAGCT GGACGAGAAG TTCTACGACG GCTCGTGCCC GGGCGTGCAC  AGGATCGTGC GGCGGGTGCT GAAGGAGGCG CACCAGGCCG ACGTGCGCAT CTACGCCAGC CTCACCCGCC TCCACTTCCA CGACTGCTTC GTCCAGGGAT GCGACGGGTC GATCCTGCTG  GACAACAGCA CGAGCATCGT GTCGGAGAAG TTCGCGAAGC CGAACAACAA CTCGGTGCGG GGGTACACGG TGGTGGACGC CGTCAAGGCG GCGCTGGAGG AGGCCTGCCC CGGCGTCGTC  TCCTGCGCCG ACATCCTCGC CGTCGCCGCC AAGATCTCTG TCGAACTGTC CGGAGGCCCC CGGTGGCGCG TCCCGCTGGG CCGGCGCGAC GGCACCACGG CCAACCTCAC GGCCGCGAAC  CACGTCCTCC CGAGCCCGCG CGACAACATC ACCATGCTCC AGCGCAAGTT CCGCGCCGTG GGCCTCGACG ACACCGACCT CGTCGCCCTC TCAGGGGCGC ACACGTTCGG GCGGGCGCAG  TGCCAGTTCG TGACGGACAG GCTCTACAAC TTCAGCAAGA CGGGGAAGCC GGACCCGACC ATGGACGCGG GCTACCGGGT GCAGCTGGCC AGGAGCTGCC CGCGGCGGCA CGGGAACAGG  ACGGCGCTCC GCGACCTCGA CCCGGCCACG CCCGACGCCT TCGACAAGAG CTACTTCACC AACCTCCAGG CCAGCCGCGG GTTCCTCCAG TCCGACCAGG AGCTGTTGTT GGCGCCCGGC  GCGCCCACGG CGGCCATCGT CGCCCGCTTC GCCGGCAGCG AGAAGGCCTT CTTCAGGAGC TTCGCTTCGT CCATGGTCAA CATGGGGAAC ATCAGGCCGC TCACGGGTGG CCAGGGAGAG  GTCCGGAAGA ATTGCTGGAA GGTTAATGGA AGCTAGCTAG GGAGTGATCG AGATACATAT GTACCATCCA CTATATATAT GATGCATACA ATCATGCATG TACCGATGTA CGTAGTTAAA 
ACTCTTTAAT TTATGAATTT GATTGCGATT TATGCACTAG 

Retrieve as FASTA