Entry information : BdiPrx49 (Bradi1g77140)
Entry ID 7843
Creation 2011-01-12 (Toky Ramarohetra)
Last sequence changes 2011-01-12 (Toky Ramarohetra)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-08 (Qiang Li)
Peroxidase information: BdiPrx49 (Bradi1g77140)
Name (synonym) BdiPrx49 (Bradi1g77140)
Class Class III peroxidase    [Orthogroup: Prx016]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Brachypodium
Organism Brachypodium distachyon    [TaxId: 15368 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BdiPrx49
start..stop
S start..stop
TaPrx55 523 0 35..331 33..329
TaPrx55-A 520 0 35..331 33..329
HvPrx27 517 0 35..331 11..307
OsPrx33 511 0 1..333 1..331
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 73503876..73504118 243 N° 2 73504747..73504935 189 N° 3 73506727..73507296 570  
join(73503876..73504118,73504747..73504935,73506727..73507296)


exon

Literature and cross-references BdiPrx49 (Bradi1g77140)
DNA ref. Phytozome 12:   Bd1 (73503876..73507296)
Protein sequence: BdiPrx49 (Bradi1g77140)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   333 (299)
PWM (Da):   %s   34590.3 (30864.2)  
PI (pH):   %s   7.68 (5.71) Peptide Signal:   %s   cut: 35 range:35-333
Sequence 374
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEAQARGGLRIPIPIRMRLLVVMLVLMAARPAMAQLAVGYYDTLCPAAEIIVQEEVSKGVSGSPGTAAGLLRLHFHDCFVRGCDASVLLDSTPGNKAEKDAPPNSSLRGFDVIDKAKTRLEQACYRVVSCADILAFAARDALALVGGSAYQVPAGRRDGNVSSAGETNGNLPPPTANVNQLTQIFGSKGLSKAQMVTLSGAHTVGAAQCSSFSSRLYSSGPNGGQDPTMDPKYLTALTAQCPQKGAQQAVPMDPVTPNAFDTNYYANLVANRGLLSSDQALLADPNASAQVVAYTSSPDTFQTDFANAMIAMGNVGVLTGNAGNIRTNCRVAS

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, intron 1, 2 and 3), no EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGAAGCGCAGGCCAGAGGAGGATTGAGAATTCCAATTCCAATTCGAATGCGGCTGTTGGTTGTGATGCTGGTGCTGATGGCGGCGAGGCCGGCGATGGCGCAGCTGGCCGTGGGGTACT
ACGACACGCTGTGCCCGGCGGCGGAGATCATCGTGCAGGAGGAGGTCAGCAAGGGCGTCTCCGGCAGCCCCGGCACGGCCGCGGGGCTCCTCCGGCTCCACTTCCACGACTGCTTCGTCA
GG
GTCAGTACTAAGAACACTGCTATATATGCTGCAGCCAGCAAATTCAGGTCCTCCAATTCATCATCCGTTGATTAATGAGGCCACCAGCTTCCAGTTCGGCGTAAGAGTGTGCAGGTAG
ATGGATAGACAATTAGACAGATAGATTGATACTTGGTCTGTTCTCTGCCTTCTGCTTCGTCTGTTTCTTGGTCTGTTCTCGCGTATCTGCTGCCTTTTACATCAGATACGAAAGGAATCG
GGCAGTAGTAGATGTGGGGAGGTAGATGGCGCTCTGCACGCATGGACGGACCTGGCCGGGCGCTTGGAGCCTTGGAGCCAGGAATGGCGACAGTCTGACAGGCCGTTGTCATGTGCATGT
TCAGTTCCAAAAGTTACCTCAACAATCACATTTTCCTCTCTCTGTTTCCTTTCTTTTCCCAAACAAAAAAAAGAAAAGAAGAAGGATACAGCTTCCACCGTACAGTCCAGCCATCCAAAC
GTGACGGTGTAGTAGTAGAGCCTAGGACAGTGATGATGCGTGCGCGTTGTTTCATTGCTAATTTCATCTGACATCATCACGAATTCATTCATCATCATCACCTTCTTTGCTCTGCTGAGT
CGTTTACTGAAACTGCAATTGCGATTGCAGGGGTGCGACGCGTCGGTGCTGCTGGACTCGACGCCGGGGAACAAGGCGGAGAAGGACGCGCCGCCAAACTCGAGCCTCCGGGGGTTCGAC
GTGATCGACAAGGCCAAGACGCGGCTCGAGCAGGCCTGCTACCGGGTCGTCTCCTGCGCCGACATCCTCGCCTTCGCCGCCCGAGACGCCCTCGCCCTG
GTAAACACACCTCACCTTCCC
CTGCCATTTCACATGTCACTGTTACTTCCCTCCATTCTTACCATCTGCAAGCTCCGAGTCGAGCGAACTTGCTCTCGGATCACGCGCAGAGGGACGTGATCTTCTGGAATACAGTATATT
AACACACATGGGGGGCGCCTCTACCGATCTCCCTAATTATGCCTTTACCGAATGGCACCAAGCTTTTCCCTCGACCTTTCTCAGAAAAGCAAGGCTGCCTTTTACAACTCCTCCTCTCAT
CTCCTCCAACAGCAGGAACAACATCCTTTGCTTTCCAAAGGGCACATTTGTACCGTAATAAGTATGCTGCCGCCTGCCTCCATCGAACGACGATATGCCTGGACAAAGAAAAGAAATGAA
TGTCTCGTTCGGGCAGCCGAATCCGGCATTGCTTTGCTCAGTCTGCGTTCCGGTGGGCACCGCACGGGGCATGCCTGTCTAAGCAACGTTTTGGCACCGCATCTGGCTGGCCCGTTGCGT
TGGGCACACGGGAGTCCGTTACGGCAGGCCAAGCGGTCGGTGTCCGTATGTGCATCAACAGCTAGCTATCAGACCGGCGTCTCCTATCCTATCCTGCGTACTCTGGCTCACATGGCCGTG
TCGCGCTCACACCGCTTCGAGAAGATCAAGAAACAAAGGAAACCTCGTTAATTTGCTTTCTCCCGAGCCTTCTTTTTCAGATGTGGCGATACAAAGGACAGGATCCGATCTGTCCGATCG
TGGCACGGTGCAGGGGGTTCAGTCAGTTAGAAAGTTTACCTAGCTTGGGCCTTTTGTTCTTTTCGTTTTTACCAGCAGTAGAATCGAGCTCTGGCACGTGTAGTGTTGGGCTAAAGGCCA
AATCATTCCCCGATCGAGCTTTGCACCGATCACTATGCAACAAGAAAAATCGTGAACCAGATGGCATCCACATGTTACTGAGCGCATGCAGGGGGACGAAGCTCGCACACCGAAGCAAAT
GATGAACTTGAGTGCTTCTAGAGTTTGTTGCTCTTTCCCGATGGAGGCAAGAATAGTTAAATTTCTCTGTCAGTCTTGCTCACGACAACGGTAGTTAACAGAAAATTAATGTGTTAGCTA
GTCATAGGGTGGAGTACACTGCTAGTCATACTACCGTTGCAGCTTTATGTGAGTGATACTGAAAGAAGTCAACGTGTTAGTATCAAGATTGATTATGGTTGATCACCGAGCACTTGGCAG
CAGCTCTTGCGACTGATCAAAGTGCATGAGCTTGAGCAGAACACTCCATGTCATGATGACCGAATACTGCCAGTGCGAGAGTGATAGTGAAGCCTGACTCACTCAGAGCTGGAAACAGCA
CATACAGGCGTTTCCCTTAAATAAACAGCACATCTGCACATAAAGGCCTCCCCTTCATGGGAAAAAGACACAGGCCACCACCAGAAACTACACTCGTGAGGACGACCGGCCGTTCGTTCG
GCCCCCAAATCAATTACCAGTAATCAAAAGAAGGGGGTTAATGGCGAGAGAGCTATCAGCAGGATTCCGGTCATCGAGTGGCGCACGTCAAGATACGTTCAGGGCCGGTCGACTTCTATA
GTTTAGTTCAGTTACGACGTGGATCCGTCCCACGCCCATGTGGCCTGCACATGCCCCATGACCCACGAATTCCGTCTCCATTCCCCAGTTGGATGGCATGGAGCCCATTGCCCGCGCTCA
CCACAAAAACGAACGGAAACAAAGCAATTCCTCTCTATATTCACTTTCTAATTCACTGAAACTTATGAGCTGTGTTTGTGTGTGTTGCAGGTGGGAGGCAGCGCGTACCAGGTGCCGGCG
GGGCGACGAGACGGGAACGTCTCGTCGGCCGGCGAAACCAACGGGAACCTGCCACCGCCCACGGCCAACGTGAACCAGCTGACCCAGATCTTCGGCTCCAAGGGCCTCTCCAAGGCCCAG
ATGGTGACGCTGTCGGGGGCGCACACGGTGGGCGCGGCCCAGTGCAGCTCCTTCAGCAGCAGGCTCTACTCGTCGGGCCCCAACGGGGGCCAGGACCCGACCATGGACCCCAAGTACCTG
ACGGCCCTCACGGCCCAGTGCCCGCAGAAAGGGGCCCAGCAGGCCGTGCCCATGGACCCCGTCACGCCCAACGCCTTCGACACGAATTATTACGCCAATCTGGTGGCTAACCGGGGCCTG
CTGTCTTCCGACCAGGCGCTGCTCGCCGACCCGAACGCGTCCGCTCAGGTGGTCGCCTACACCAGCAGCCCTGACACGTTCCAGACCGACTTTGCTAATGCCATGATCGCCATGGGGAAT
GTTGGCGTGCTCACTGGGAACGCCGGGAACATCAGGACCAACTGCAGAGTAGCCTCCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGAAGCGCAGGCCAGAGGAGGATTGAGAATTCCAATTCCAATTCGAATGCGGCTGTTGGTTGTGATGCTGGTGCTGATGGCGGCGAGGCCGGCGATGGCGCAGCTGGCCGTGGGGTACT
ACGACACGCTGTGCCCGGCGGCGGAGATCATCGTGCAGGAGGAGGTCAGCAAGGGCGTCTCCGGCAGCCCCGGCACGGCCGCGGGGCTCCTCCGGCTCCACTTCCACGACTGCTTCGTCA
GG
GGGTGCGACGCGTCGGTGCTGCTGGACTCGACGCCGGGGAACAAGGCGGAGAAGGACGCGCCGCCAAACTCGAGCCTCCGGGGGTTCGACGTGATCGACAAGGCCAAGACGCGGCTCG
AGCAGGCCTGCTACCGGGTCGTCTCCTGCGCCGACATCCTCGCCTTCGCCGCCCGAGACGCCCTCGCCCTG
GTGGGAGGCAGCGCGTACCAGGTGCCGGCGGGGCGACGAGACGGGAACG
TCTCGTCGGCCGGCGAAACCAACGGGAACCTGCCACCGCCCACGGCCAACGTGAACCAGCTGACCCAGATCTTCGGCTCCAAGGGCCTCTCCAAGGCCCAGATGGTGACGCTGTCGGGGG
CGCACACGGTGGGCGCGGCCCAGTGCAGCTCCTTCAGCAGCAGGCTCTACTCGTCGGGCCCCAACGGGGGCCAGGACCCGACCATGGACCCCAAGTACCTGACGGCCCTCACGGCCCAGT
GCCCGCAGAAAGGGGCCCAGCAGGCCGTGCCCATGGACCCCGTCACGCCCAACGCCTTCGACACGAATTATTACGCCAATCTGGTGGCTAACCGGGGCCTGCTGTCTTCCGACCAGGCGC
TGCTCGCCGACCCGAACGCGTCCGCTCAGGTGGTCGCCTACACCAGCAGCCCTGACACGTTCCAGACCGACTTTGCTAATGCCATGATCGCCATGGGGAATGTTGGCGTGCTCACTGGGA
ACGCCGGGAACATCAGGACCAACTGCAGAGTAGCCTCCTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CCTATAAACC ACACCCTGAT ATTCTCCTCC CCACCCTTCT TCTTAACCAA GAAGCACTTC CTCACTGAAA CAAGCCTCAA ACCGTCTAGC TCTCGCAAGA TTAGCCCTTA AGCAAGAGCT  GAGAATTGGC AATCCAGAGC TAGTTTTTCT GGACCAAAAA TCCAGAGCTA GTTAAGCAGG GAGAGAGAGA TGGAAGCGCA GGCCAGAGGA GGATTGAGAA TTCCAATTCC AATTCGAATG  CGGCTGTTGG TTGTGATGCT GGTGCTGATG GCGGCGAGGC CGGCGATGGC GCAGCTGGCC GTGGGGTACT ACGACACGCT GTGCCCGGCG GCGGAGATCA TCGTGCAGGA GGAGGTCAGC  AAGGGCGTCT CCGGCAGCCC CGGCACGGCC GCGGGGCTCC TCCGGCTCCA CTTCCACGAC TGCTTCGTCA GGGGGTGCGA CGCGTCGGTG CTGCTGGACT CGACGCCGGG GAACAAGGCG  GAGAAGGACG CGCCGCCAAA CTCGAGCCTC CGGGGGTTCG ACGTGATCGA CAAGGCCAAG ACGCGGCTCG AGCAGGCCTG CTACCGGGTC GTCTCCTGCG CCGACATCCT CGCCTTCGCC  GCCCGAGACG CCCTCGCCCT GGTGGGAGGC AGCGCGTACC AGGTGCCGGC GGGGCGACGA GACGGGAACG TCTCGTCGGC CGGCGAAACC AACGGGAACC TGCCACCGCC CACGGCCAAC  GTGAACCAGC TGACCCAGAT CTTCGGCTCC AAGGGCCTCT CCAAGGCCCA GATGGTGACG CTGTCGGGGG CGCACACGGT GGGCGCGGCC CAGTGCAGCT CCTTCAGCAG CAGGCTCTAC  TCGTCGGGCC CCAACGGGGG CCAGGACCCG ACCATGGACC CCAAGTACCT GACGGCCCTC ACGGCCCAGT GCCCGCAGAA AGGGGCCCAG CAGGCCGTGC CCATGGACCC CGTCACGCCC  AACGCCTTCG ACACGAATTA TTACGCCAAT CTGGTGGCTA ACCGGGGCCT GCTGTCTTCC GACCAGGCGC TGCTCGCCGA CCCGAACGCG TCCGCTCAGG TGGTCGCCTA CACCAGCAGC  CCTGACACGT TCCAGACCGA CTTTGCTAAT GCCATGATCG CCATGGGGAA TGTTGGCGTG CTCACTGGGA ACGCCGGGAA CATCAGGACC AACTGCAGAG TAGCCTCCTG ATTCAGCTGA  GATTAGAGTT GATCGATTGA AGGCTTGGTT CAAATGTATG TAGTCCGTTC TGTCGTGCTA GCTAGCTAGC TTAATTAGCT CCTCCCATCT TTTTTCTTCT CCTTTTCCTC TCTTACATAT  ATAGTACTGG TACTTTCCTT TTGTGCTTGG ATTCTTTTAG CCTCTGTATG TAGTATCTAG CTAGCTAGCT AGTTACCGGA TTCATAACTG TATATGTGAT GATTGGATAC CCAACAGTGC 
TTAATAAGAA GCTATATATA CGGATCGGAA CAGGCAGTTG CTGCCACTGT 

Retrieve as FASTA