Entry information : ZmPrx75
Entry ID 785
Creation 2009-01-12 (Christophe Dunand)
Last sequence changes 2011-02-17 (Christophe Dunand)
Sequence status partial
Reviewer Qiang Li
Last annotation changes 2011-09-04 (Qiang Li)
Peroxidase information: ZmPrx75
Name ZmPrx75
Class Class III peroxidase     [Orthogroup: Prx067]*
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrx75
start..stop
S start..stop
ZmPrx104 595 0 7..337 23..353
ZmPrx40 592 0 7..336 25..354
SofPrx12 587 0 14..337 24..341
SbPrx108 577 0 10..336 18..341
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 129861086..129861280 195 N° 2 129857747..129858415 669 N° 3 129852172..129852324 153  
complement(join(129852172..129852324,129857747..129858415,129861086..129861280))


exon

Literature and cross-references ZmPrx75
Literature Walbot,V., unpublished.
Protein sequence: ZmPrx75
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   338
PWM (Da):   %s   36241.52  
PI (pH):   %s   6.92
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ASVYLVAAAEASQSHHGSGLELGYYKTACPGVESVVKYHVAKAISANRGAGAALVRLIFHDCFVRGCDASVLLDPTPANPETEKTAPINIGLAAFDVIDDIKAALEERCPGTVSCADILVYAARDASSILSNGRVRFAAPAGRLDGVVSRAADAQRDLPDSTFTVAELVRNFRRKNFTVEELVILSGAHAVGVGHCSSFRARLSAPPAQIVPAYRDLLSAKCGAEGPGADPVVPNNVRDEDPRAVAAAFPPFLGKLRRTRDLLDNSYYHNNLARVVTFNSDWQLLTEKEALGHVKEYAENGTLWDEDFSDALLKLSKLPMPPNNKGEIRKTCRCVNHR*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 8, introns 1 and 3). Short PS is missing. No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GCTTCTGTGTACTTAGTGGCGGCGGCAGAGGCCTCCCAGTCCCACCACGGCAGCGGCCTCGAGCTGGGCTACTACAAGACGGCCTGCCCCGGCGTGGAGAGCGTGGTCAAGTACCACGTC
GCCAAGGCCATCAGCGCCAACCGCGGCGCCGGCGCCGCGCTCGTCCGCCTCATCTTCCACGACTGCTTCGTCAGG
GTACGTACGTGAGTTCTACTGCTGTCAGTCTGCTCACTTAATTAA
GCTTGCTCGTTACAAAACTAATAAACATCGCTCGTTTCATATACTCCAAACCAAACATGCACCTTCGTACGTACAATGTACGCGCACACGTACGTGGACTAATTAAGCAACAAAGCACTC
CATCCATCATCACTTGGACGAACATGCATCTTGTCAAAAGTTCCAAGCAGTAGCAGCAGCCTGTAGCTTATTAGCTTCAGCATAGCACTAACACTTGTCAAATTAAAGTTCCGTGCGCAG
CTTGTTCACTGCAACTGCGTTATTATGGCGCGAAAGGGAGTCTTCATTTAATATAAATTATGACAAAATCACAAGCACTGAAGTAAAAAGTCAAATCAGATGATGCGTACTGAATATAAA
TTATGACAAAATCTGTATACTAAAGTTTAGCTTATATCACATCAGATGTTTGAATACCGGCGGTTATGAGTGAAGGATTTATTAAGCCTAAATTAATTCATGGTTATCAAATGTTTACTC
TAGTCTAGCATTATAAGGGTGTGTACAACCCTATTTAATATAGGGTCTCTTGAGGGATCTCTAAGGGGCTATGTGAAAAAAAATACAAGAGACGAGTTATTTGTGAAGAGTCCGTCTCTT
CATAACTCTCTATATGCATGTTGTCACTTAACTACATTTATGATCTATAGCCTCAGGGTTATATCATGCAGTCTCTTATCTGTCTCGTGTACTTAGAAAACTAAAACGGAGTCTCAAGAT
TGTACATGCCCTAAGGATGAATGATGTACTAATTATACTTAATAAACCCTTTTTTACCATTTAGTTTAATAATCATCTACAATAATTAAATCATGTTTAATATTTGACAGAACTAATTTA
ATTAGTTACATGGAACCAAACACCCTGTCTCTTGTAACCACTAGTCTACTGGCCTAGCTTGAAGTATAAGAGCATGTTTGGTGTATGGCCTAAGCTGCCACAGTCCACCGCACTTCAACC
GCCGCAGTTGTGGCGGCCAATTTAACCGCCGTAAGTTAGGCGCGGTGTGGTGGTCGAGACGCCACACCAAACAGACCCTAAATACCTCGTATATCCAATGGACACATGCAAGGCCTCCTT
TTAGGAGTGGCCAATCTAGCAGAAAATATCGTCATTAGGGTTAGCTTTGTTGTATAATATAAATTTTCTTAAACTTTAATAATAATTTCCTTTTATCGGGATTACTGACCCCGATAAACA
ACTAGATTCGCCGCTGCCTTTTAGGTAGACCCTCGCCCCATACGTGTTTCCCTGTCCTTTTGATCGCAGCTTCCATGTATTTCTGATTGCTAAATGATAACTAACATGCAACCACCCGGT
ATTTATTTCTTGTGACTTTCTTCGGTACCTACTATACTACCCATCTCAGTCACAACATTTTTTTATATATACATCCTACTCATTTGATTTTATCCTGATGGAAAATTGGCCCCTTCTTTG
AAAACGTGACTAGGTACATGTAGGTTTTATTATTTGAAAACAGGGGCTGGGATGTCTAGATTGATGGAGGTTGATGCTTCAACTGTTGTTTATGAGTGGCATGTGAAAACCAGAGTTGGA
AAGAGCTACGTGCAATAGGAGAGATTAAGATGGCCGCGCATGAATCATTGGTTCCACTAGTCCCCTAAATATATATAAAAATTGAGTACTCATAGGACACTAGTCTCCTAAATATATAAA
AAATTGAGTACTCATAGGCAACCTCCGATGCAATGCAATGCAATGCTTTTCAGCTTGTGCTATTATATAGAAAAAGGCATCCATTTGTAAACATGTATAGTCCACGCATGCACACACTAG
CTTTATATACTACCCTTCCCAACAATTAACATAAAAGTGCACACACTAGCTTTATATACACCCTAGCCTTATATATAGTCCACGCATACATATAGCAATACGTATATGTGCATAAAATGG
GTGTTCATTAGCAGAACAATTGACAACAATTGATGCACAATATAATGTCCCAAATAAATGTAAATACAATATTGGATTGGATGGCTGCACACGAACGCGCAAGCTCCTGCGAAAAGGTGG
CCAACCGGATACGTCCGTTTTTCCGTTTTGAACGTATGTGCGGATGCATGTAAATTGACTTATCTTACATTCGTCTATGCAGTCCATGTTTTTCGCATACATAGGTAACTCAAACAGATA
AAATCAACACACGCAGTGGTCTAGAATAAGACGACACGTCAATGAGATAGAATGCATAACAACCCATGCATCATCATCCTCTACCGACACTATTACATATGATATGAAGTGGACATCCCT
TTCCATCAAACCATCCGATGGGCCGGGGAGCGTGTTTGAGTAGTAGTATAATTAAAAGCTCCATCTGTACGTATCAGTCCCGAGATGACGAAATGACTTGCCATGCACACTTGACACGTC
AGTCTACAGCAGCAGCAACAGCGACAGGTTGTTACACTAATAGCTACTAATAAGCTTATAGTCGAGCTGTTTTATTGCATTGCACCAGTACGTGTACTGATGAATGATGATACACCTATA
GGGTTCTTCAATTCATCAGTTGGGTTGATTCTTTCTTCGTCAAGGCCTCAAGGGTGGCGGAGATGTCATTTTCACAATAAATCAACTGAAAGAACGTGCATGCAGGGGTGCGACGCGTCG
GTTCTCCTTGACCCGACGCCGGCCAACCCGGAGACAGAGAAGACGGCGCCGATCAACATCGGGCTGGCGGCGTTCGACGTGATCGACGACATCAAGGCGGCGCTGGAGGAGCGGTGCCCC
GGCACGGTGTCGTGCGCGGACATCCTGGTGTACGCGGCGCGGGACGCGTCGAGCATCCTGAGCAACGGGCGCGTGCGCTTCGCCGCGCCCGCGGGGCGGCTGGACGGCGTGGTCTCCCGC
GCCGCCGACGCGCAGCGCGACCTGCCGGACTCCACCTTCACCGTGGCCGAGCTGGTCCGCAACTTCCGCCGGAAGAACTTCACGGTGGAGGAGCTAGTGATCCTGTCGGGCGCGCACGCC
GTCGGCGTCGGCCACTGCTCCTCGTTCCGCGCCCGCCTGTCGGCGCCGCCGGCCCAGATCGTGCCGGCGTACCGGGACCTGCTGTCGGCCAAGTGCGGCGCGGAGGGGCCCGGAGCCGAC
CCCGTGGTGCCCAACAACGTGCGCGACGAGGACCCGCGCGCCGTGGCGGCTGCGTTCCCGCCCTTCCTCGGCAAGCTGCGCCGGACCAGGGACTTGTTGGACAACAGCTACTACCACAAC
AACCTGGCGCGGGTAGTCACCTTTAATTCCGACTGGCAGCTGCTCACGGAGAAG
GAGTGTGAGGATGGATGCACCAAAGCAAGGAGATAAAAGAGCTCGGGTTCCTGCTGATGTGGAAAC
TAGAAGGGGAACAAGAGCGAGGAAGGCAAGCGTGAAGGTGTTTGGGCCGGATTGGCGTGTGTAAGACGCTGTGCGTCTGGTGGGCCGAATGTGGCCGGAATGTGTGAACGTGTGCTCCAA
GTTGGGGTAACGCTGGAGGTTATAGGGGAGTAGCTGGTAAAGGAGAGGAATCAGAAAAAGCATAACAAACTCATTCTGTACCAACTCTTTCAGTTCTATACGACAGCTTCTCCTTCTCCT
CCTATCTTCCTACTGTTCTTCCTTTACCTGCAAATTCTGCTAACAATCTGGTATCAGAGGTATTCGATTCCTAGCGGGCTACAAGCTAGATCCAGTTCCCAGCCACAATTATTTCACCCG
TTTCCAGAAGCGTCAAGGAGCCATGGATGCGAGCACCAAACTCATCCTCGACGAGATGGAGAAAAAATTTTCGACACTGGATGCCAAGTGGGAACAGCGGTTCTCGGAGGTGGTCGCCAT
CAAGGAGGAGCGCTTGGGCGCGCTCGAGAACTCGACTGCCGAGTTGGAGGCGTGGAGACCCAAGGTGGATTCCGCCTTGGAAGATGTCAAGCTCGAGTTGAGGAAACTCAACAAGCAATG
GGATCGCTCCTTCATGGATCCGCAAACCGGGGATTCAGGTCTCCTGCTCCGGCCTGAGGCCGAGCCGTCGTTCCGTCTGAAGGGCAACGAGGAGAACCAGATTCGTGATCCGGGGTACGG
ATCAGTGACGACCTTCATGCCGGGCTCGGGCAAGGGTATGCACAACTTCCACTCACCCCCAGTTATTCCGAATCATATGCTCTCTAGTACTCCTGGTGATTTGGGTGGGGTCGGAGGTTT
TGATTCTGCCCCTACACATCATTCTACGGGCAAGTTACCCACAATTTCATTCCCATTGTTTGATGGTACTCATCCCCAGTTTTGGATTTCTCGCTGTGAAGTATATTTTGATATGTATAG
TGTGGATCAGACCTCCTGGGTTAAAGTGGCTAAAATGCATTTCTCCCCACTGGTTGCCTGTTGGTTTCAGTCCATTGAGCGTCGCTATCAGCCTCTGCCATGGCAGTTGTTTTGTAAGCT
TCTTTTGGACAGGTTCAGCAAGGATCAACATCAGTCCCTGTTGCGTCAGATGTTTCGTATTAAGCAGACGACAACGGTGGCTGACTATATTGAGAAATTCTGTGTCCTGGTTGATCAATT
AACAGCTTATGAGTCAGTGTTTGATCCCTTATATTTCACAACTCGGTTTATGGAAGGCCTGAGGGAGGATATTCGTGCTGTCGTAATGCTACAACGACCTCCAGACCTCGACACTGCTTG
TACCTTGGCCACGTTACAGGAAGAAGTTTCGGAACCGATGAAGCGTAAGGAAGTTCGTCGGTTTGATGGCAATCTGTGGAACAAACCTTCAGTCAAGAACACACTACCACCAACAGCAGA
CAAGGCAGTGCCTGCAGATCAACGCCCAGGGCCCCTTCCTCAGACTATGGTTGATAGAATGGGAGCACTTAGGTCCTACAGGCGTGCTCGAGGCCTGTGTGATAAGTGTGCTGAGAAATG
GCATAAGGGACATACATGTGCGACGACTGTCCAGCTTCAGGCCATACAGGAAGTCTGGGAGTTGTTCGAGCCTGAAGAATCAGCTTCTGGAGAAGAGTCAGAAGTACTTCCAGAGGAGCA
TGTGTTTTCTGCTCTTTCCTTTGAAGCAGTGTCAGGTGGTAAGGCTAAAAGAGCTATGCAACTAGGAGGTCGTTTAAAGGATCAAGATGTCAGCATACTTATTGATTCAGGTAGTACTCA
TTCCTTTGTAAGCCAACAATTGGTGGCTAAGCTTCATCTACCAGAGGAGAGTACTGCCCCCATTCAGGTCAGAGTGGCGAATGGAGAAGTAATGTTGTGTCAGACTTCGATCATCCAAGC
CATCTGGTCTATTCACCATTACCAGTTCCAGATGGATCTAAAGATTTTACCCCTGGCTGTCTATGACATTATCCTAGGTATGGACTGGTTAGAACAGTTCAGTCCTATGGAGGTCCATTG
GTGTCAGAAATGGATGTTGATACCATACCAGGGAGAACCCATACTCTTGCAAGGTTTGTCCAAAGGAGTGGAGGAAAAATTCCTTATACATGTTACTGAGGTTGATGATTCTTCCATTAA
TACATCTGCACCAGAATTACCATCTGCTATTACTGCATTACTACAACAGTTTGCTGATGTGATGTCACCACCTGTGGAGTTACCACCAGTCAGGAACTGTGATCATAGTATTCCTCTCAT
TGCAGGGGCTCATCCGGTGTATATTCGACCTTATAGGTTTGCACCAGCACTTAAGGATGAAATTGAGCATCAGGTGACTGAAATGTTACAAAAAGGGTTAATCAGACCTAGCACGTCTGC
CTTTTCCTCTCCTGTTTTATTAGTCAAAAAGAAGGATGGATCTTTCCGATTTTGTGTGGACTATAGGTATTTAAATACCTTAACACTAAAGAGTAGATTTCCTATTCCCATATTCGATCA
GCTAGTGGACGAGTTGTCAGGCGCAAGTTGGTTTTCTACTCTGGATTTGATTTCTGGCTACCACCAAGTGAGGATGAAGCAAGGAGAGGAACATAAAACAGCCTTTCAGACCCATCACGG
TCATTTCGAATTCTTGGTTATGCCTTTTGGATTATCAGGTTCCCCTGGGACTTTTCAGAATGCTATGAACACATCTTTGGCCCCACTACTTCGTAAATGTGTCATTGTATTTTTTGATGA
TATTCTTGTGTACAGTCACACATTGGATGATCATGTGGCTCACTTGACAGCAGTTTTGACTATTCTGCGTCAAGATCATTGGCATGTGAAGCCCTCTAAATGTTCTTTTGCTAAGAGGCA
AATTTCTTATTTGGGACATATAATCAGTGAACTTGGGGTGTCAACTGATATGTCTAAGGTTGAAGCAGTCTTACAGTGGCCTTCTCCCACCAATCTCAAGGAGCTAAGAAGTTTTTTAGG
TTTGGCAGGATACTATAGAAAGTTTATCAAGCATTTTGCTTTGATTACTAAACCTCTCACTGCCTTACTTAAGAAGGGTGTGTGGTTTGTGTGGACTGCTGAGCAGGAGTTAGCATTTTC
CACAGTTAAAAAGGCCCTAAGCACTGCCCCAGTTTTGGCTCTACCTAACTTCTCCAAACAGTTTTGTATTGAAACTGATGCTTGTAAGAATGGGGTTGGAGCTGTGTTGTTACAGGATGG
GCACCCTTTGGCATACATCAGCAAGTCATTGGGGGTTAAGACACAATGCTTGTCCACATATGAGAAAGAATATTTAGCTATTTTGCTGGCAATTGAGCAATGGAGACCTTATTTGCTGCA
TGGGGAATTTCTGATCTTCACTGACCAGAAAAGTCTCATCCACTTGAATGAGCAGAGACTCAATACGCCTTGGCAACAAAAAGTGTTTACCAAGTTACTTGGCATGCAGTATAAGATTGT
GTACAAACCAGGGTCAGATAATAGGGTGGCTGATGCTTTATCTCGAAGGGCCCCGGATAATGGCCAGCGTTGTGCAATTTCAGTACTAAAACCACAGTGGTGCCAAGCAGTCCTGGATGG
GTATTTGGAAGACACTGAGTCCAAGGAACTTTTGGCCAAGTTATCTCTCAACCCTGTGGCCGTGCCTGACTTCGAATTGCATGATGGTTTGCTCAGGTACAAAGGGAAAATATGGTTAGG
CAACAATGTCACATTGCATCACACTGTGATGACAGCCATGCATTGCTCTGCAGTGGGAGGTCACTCTGGGTTCCCAGTAACATACCACAGACTGAAGCAATTGTTTTCCTGGCCTGGTAT
GCGGAAGTGCGTTCAAAATTTTGTGGCCGCTTGTACTACTTGTCAGCAAGCTAAACCTGACCGATCTAAATATCCTGGGCTTCTCCAACCTCTACCAGTTCCTAGTGGGGCATGGCAAAC
TATCTCCATGGATTTTGTTGAGGGCTTACCCATGTCAGGAGGCAAAAATTGTGTGCTGGTGGTGGTGGATAAATTTTCTAAATTCAGCCACTTTGTTCCTCTCAAACACCCCTTTACTGC
TGCGATAGTAGCTAAAGTTTTTATGCAGCAAGTATATAGACTTCATGGGTTACCTCTGGCAATTGTGTCTGACAGGGATAGAATTTTTACTAGTCAATTGTGGAAATCCTTGTTCTCACT
AGCTGGAGTGTCCTTAAATATGAGTAGTGCATATCACCCACAATCCGATGGACAGACTGAAAGGGTCAATCAGTGTATGGAAACGTTTTTGCGCTGTTTTGTACACGCTTGCCCTTCTAA
GTGGGTGGATTGGATATACTTGGCTGAATATTGGTATAACTGCAGTTGGCATTCGTCCTTGGGTTTCTCCCCATTTGAGGTACTGTATGGGTATACTCCTAAACACTTTGGTGTGGATGC
CAATGCTGCATGTCCTGTTCCATCTCTGGCTCAATGGATGCAAGATAAAACAGTGATGTCTGAGCTGGTCCAACAACATTTATCCAGAGCTCAGCTGAGGATGAAGAAACAAGCTGATCA
AGGGCGTTCTGAAAGGTCGTTTGCTGTGGGGGACCAAGTCTTTCTGAAGCTCCAACCTTATGTGCAATCCTCTTTGGCTCCCCGCGCGAACCAAAAGCTGGCTTTTAAATATTTCGGCCC
TTTTTCCATAGTGGCTAAAGTGGGAACTGTTGCTTACCGTTTGCAACTGCCAGCTTCATCTTCTATTCATCCTGTTTTTCATGTATCTCAGTTGAAAAAAGCAGTGGGTCCGGCAGTGCA
GGTATCTCAGCTACCGGGAGAGATGGTTGACATTCAGGTTCCCGAAGCCATACTGCAACGCCGGCTGGATTCTGAAGGTAAATCACAAGTGCTGGTGAAGTGGTCGGCCATGCCAGAATC
CTTAGCTACATGGGAGGATGCTATTGCCCTGCGACAGAGCTTTCCATTTGCACCTGCTTGGGGACAAGCAGTGTCTCTTCCAGGGGGAATGTGAGGATGGATGCACCAAAGCAAGGAGAT
AAAAGAGCTCGGGTTCCGGCTGATGTGGAAACTAGAAGGGGAACAAGAGTGAGGAAGGCAAGCGTGAAGGTGTTTGGGCCGGATTGGCGTGTGTAAGACGCTGTGCGTCTGGTGGGCCGA
ATGTGGCCGGAATGTGTGAACGTGTGCTCCAAGTTGGGGTAACGCTGGAGGTTATAGGGGAGTAGCTGGTAAAGGAGAGGAATCAGAAAAAGCATAACAAACTCATTCTATACCAACTCT
TTCAGTTCTATACGACAACTTCTCCTTCTCCTATCTTCCTACTGTTCTTCCTTTACCTGCAAATTCTGCTAACAAGGAGGCGCTGGGGCACGTCAAGGAGTACGCCGAGAACGGCACGCT
GTGGGACGAGGACTTCTCCGACGCGCTCCTCAAGCTCAGCAAGCTGCCCATGCCGCCCAACAACAAGGGCGAGATCAGGAAGACCTGCCGCTGTGTCAACCACCGCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GCTTCTGTGTACTTAGTGGCGGCGGCAGAGGCCTCCCAGTCCCACCACGGCAGCGGCCTCGAGCTGGGCTACTACAAGACGGCCTGCCCCGGCGTGGAGAGCGTGGTCAAGTACCACGTC
GCCAAGGCCATCAGCGCCAACCGCGGCGCCGGCGCCGCGCTCGTCCGCCTCATCTTCCACGACTGCTTCGTCAGG
GGGTGCGACGCGTCGGTTCTCCTTGACCCGACGCCGGCCAACCCG
GAGACAGAGAAGACGGCGCCGATCAACATCGGGCTGGCGGCGTTCGACGTGATCGACGACATCAAGGCGGCGCTGGAGGAGCGGTGCCCCGGCACGGTGTCGTGCGCGGACATCCTGGTG
TACGCGGCGCGGGACGCGTCGAGCATCCTGAGCAACGGGCGCGTGCGCTTCGCCGCGCCCGCGGGGCGGCTGGACGGCGTGGTCTCCCGCGCCGCCGACGCGCAGCGCGACCTGCCGGAC
TCCACCTTCACCGTGGCCGAGCTGGTCCGCAACTTCCGCCGGAAGAACTTCACGGTGGAGGAGCTAGTGATCCTGTCGGGCGCGCACGCCGTCGGCGTCGGCCACTGCTCCTCGTTCCGC
GCCCGCCTGTCGGCGCCGCCGGCCCAGATCGTGCCGGCGTACCGGGACCTGCTGTCGGCCAAGTGCGGCGCGGAGGGGCCCGGAGCCGACCCCGTGGTGCCCAACAACGTGCGCGACGAG
GACCCGCGCGCCGTGGCGGCTGCGTTCCCGCCCTTCCTCGGCAAGCTGCGCCGGACCAGGGACTTGTTGGACAACAGCTACTACCACAACAACCTGGCGCGGGTAGTCACCTTTAATTCC
GACTGGCAGCTGCTCACGGAGAAG
GAGGCGCTGGGGCACGTCAAGGAGTACGCCGAGAACGGCACGCTGTGGGACGAGGACTTCTCCGACGCGCTCCTCAAGCTCAGCAAGCTGCCCATG
CCGCCCAACAACAAGGGCGAGATCAGGAAGACCTGCCGCTGTGTCAACCACCGCTGA

Retrieve as FASTA