1. Browse the Database
  2. View Redoxidase
Entry information : ZmPrx[P]75(Zm00001d010926)
Entry ID 785
Creation 2009-01-12 (Christophe Dunand)
Last sequence changes 2011-02-17 (Christophe Dunand)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2023-01-04 (Christophe Dunand)
Peroxidase information: ZmPrx[P]75(Zm00001d010926)
Name ZmPrx[P]75(Zm00001d010926)
Class Class III peroxidase     [Orthogroup: Prx067]*
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrx[P]75
start..stop		 S start..stop
ZmPrx104 595 0 7..337 23..353
SofPrx12 587 0 14..337 24..341
SbPrx108 577 0 10..336 18..341
SiPrx91 566 0 18..337 27..343
Gene structure Fichier Exons►


exon

Literature and cross-references ZmPrx[P]75(Zm00001d010926)
Literature Walbot,V., unpublished.
Protein sequence: ZmPrx[P]75(Zm00001d010926)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   338
PWM (Da):   %s   36241.52  
PI (pH):   %s   6.92
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ASVYLVAAAEASQSHHGSGLELGYYKTACPGVESVVKYHVAKAISANRGAGAALVRLIFHDCFVRGCDASVLLDPTPANPETEKTAPINIGLAAFDVIDDIKAALEERCPGTVSCADILV
YAARDASSILSNGRVRFAAPAGRLDGVVSRAADAQRDLPDSTFTVAELVRNFRRKNFTVEELVILSGAHAVGVGHCSSFRARLSAPPAQIVPAYRDLLSAKCGAEGPGADPVVPNNVRDE
DPRAVAAAFPPFLGKLRRTRDLLDNSYYHNNLARVVTFNSDWQLLTEKEALGHVKEYAENGTLWDEDFSDALLKLSKLPMPPNNKGEIRKTCRCVNHR*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 8, introns 1 and 3). Short PS is missing. No EST. Uncorrect prediction from Phytozome (exon 1 is not found in the DNA, end of exon 4 not predicted)
DNA ►
Send to BLAST
CDS►
Send to BLAST