Entry information : BdiPrx71 (Bradi2g20830)
Entry ID 7861
Creation 2011-01-13 (Toky Ramarohetra)
Last sequence changes 2011-01-13 (Toky Ramarohetra)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-08 (Qiang Li)
Peroxidase information: BdiPrx71 (Bradi2g20830)
Name (synonym) BdiPrx71 (Bradi2g20830)
Class Class III peroxidase    [Orthogroup: Prx004]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Brachypodium
Organism Brachypodium distachyon    [TaxId: 15368 ]
Cellular localisation N/D
Tissue type Roots
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BdiPrx71
start..stop
S start..stop
BdiPrx73 590 0 1..323 1..326
BdiPrx72 578 0 17..323 18..327
AvePrx109-1A 549 0 1..323 1..326
TaPrx100 548 0 1..323 1..326
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 18271658..18271855 198 N° 2 18271961..18272146 186 N° 3 18272247..18272837 591  
join(18271658..18271855,18271961..18272146,18272247..18272837)


exon

Literature and cross-references BdiPrx71 (Bradi2g20830)
Literature Vogel,J.P., Gu,Y.Q., Twigg,P., Lazo,G.R., Laudencia-Chingcuanco,D., Hayden,D.M., Donze,T.J., Vivian,L.A., Stamova,B. and Coleman-Derr,D.
EST sequencing and phylogenetic analysis of the model grass Brachypodium distachyon. Theor Appl Genet 113 (2), 186-195 (2006).

DNA ref. Phytozome 12:   Bd2 (18271658..18272837)
Protein sequence: BdiPrx71 (Bradi2g20830)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   324 (302)
PWM (Da):   %s   35313.63 (33174.4)  
PI (pH):   %s   6.51 (5.97) Peptide Signal:   %s   cut: 23 range:23-324
Sequence 365
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASRALMVALLLAAVAVGCARAQLREKFYSESCPSVEEVVRKEMMRAPRSLAAPILRMHFHDCFVRGCDGSVLLDSANKTAEKDGQPNQTLRGFGFVDTVKAAVEKACPDTVSCADVLALMARDAVWLTKGPFWEVPLGRRDGSVSISNETDQLPPPTSNFTVLTQLFAAKNLDAKDLVVLSAGHTIGTSHCVSFTDRLFNFTGRVNPTDVDPTLDSEYMDKLKGKCTSLNDNTTLVEMDPGSFKTFDLDYFTVVAKRRGLFHSDGALLTDDFTRAYVQRHAGGAFKEEFFADFAASMIKMGNVDVLTGTQGEIRKKCSVPNHH

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 2, 2 introns). 1 EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCGTCGAGGGCTCTGATGGTGGCGCTGCTGCTCGCGGCGGTGGCCGTGGGGTGCGCGCGGGCGCAGCTGCGCGAGAAGTTCTACAGCGAGTCCTGCCCCAGCGTGGAGGAAGTCGTGA
GGAAGGAGATGATGAGGGCGCCTCGCAGCCTCGCCGCGCCGATCCTCAGGATGCACTTCCACGACTGCTTCGTCCGG
GTAAGCAATGCGCATTCATCCTCAACAATCGTTGCAAAATTCA
GTGGCTGGCCGTTTATGTTCAGTGGCCCTGACAGCAGTGAATGAATGGATATATACATGCAGGGGTGCGACGGGTCGGTTCTGCTGGACTCGGCGAACAAGACGGCGGAGAAGGACGGGC
AGCCCAACCAGACCCTGCGCGGGTTCGGCTTCGTCGATACGGTGAAGGCCGCCGTGGAGAAGGCGTGCCCCGACACCGTCTCCTGCGCCGACGTGCTCGCCCTCATGGCCAGGGACGCAG
TCTGGCTG
GTCAGCACAACACGGACATCGCTTTGACATCCAACATTCCAAGCTGAACAACCAAAGTTCTTAATGCTGCTCGATCGTGGTTTTTTTTGTTTTGTTTCAGACCAAGGGGCCA
TTCTGGGAAGTTCCTCTGGGCCGGCGAGACGGCAGCGTGTCCATCTCCAACGAGACCGACCAGCTCCCGCCCCCGACCTCCAACTTCACCGTGCTGACCCAGCTCTTCGCCGCCAAGAAC
CTCGACGCCAAGGACCTCGTCGTCCTCTCCGCCGGCCACACCATCGGGACCTCGCACTGCGTCTCCTTCACCGACCGCCTCTTCAACTTCACCGGCAGGGTCAACCCCACCGACGTCGAC
CCGACGCTCGACTCGGAGTACATGGACAAGCTCAAGGGCAAGTGCACCAGCCTCAACGACAACACGACGCTGGTGGAGATGGACCCGGGGAGCTTCAAGACCTTCGACCTCGACTACTTC
ACCGTCGTGGCCAAGCGGAGGGGCCTCTTCCACTCCGACGGCGCCCTGCTCACCGACGACTTCACCCGCGCCTACGTGCAGCGCCACGCGGGCGGCGCCTTCAAGGAGGAGTTCTTCGCC
GACTTCGCCGCGTCCATGATCAAGATGGGCAATGTCGACGTGCTCACCGGTACCCAGGGCGAGATCAGGAAGAAGTGCTCCGTGCCTAATCATCATTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCGTCGAGGGCTCTGATGGTGGCGCTGCTGCTCGCGGCGGTGGCCGTGGGGTGCGCGCGGGCGCAGCTGCGCGAGAAGTTCTACAGCGAGTCCTGCCCCAGCGTGGAGGAAGTCGTGA
GGAAGGAGATGATGAGGGCGCCTCGCAGCCTCGCCGCGCCGATCCTCAGGATGCACTTCCACGACTGCTTCGTCCGG
GGGTGCGACGGGTCGGTTCTGCTGGACTCGGCGAACAAGACGG
CGGAGAAGGACGGGCAGCCCAACCAGACCCTGCGCGGGTTCGGCTTCGTCGATACGGTGAAGGCCGCCGTGGAGAAGGCGTGCCCCGACACCGTCTCCTGCGCCGACGTGCTCGCCCTCA
TGGCCAGGGACGCAGTCTGGCTG
ACCAAGGGGCCATTCTGGGAAGTTCCTCTGGGCCGGCGAGACGGCAGCGTGTCCATCTCCAACGAGACCGACCAGCTCCCGCCCCCGACCTCCAACT
TCACCGTGCTGACCCAGCTCTTCGCCGCCAAGAACCTCGACGCCAAGGACCTCGTCGTCCTCTCCGCCGGCCACACCATCGGGACCTCGCACTGCGTCTCCTTCACCGACCGCCTCTTCA
ACTTCACCGGCAGGGTCAACCCCACCGACGTCGACCCGACGCTCGACTCGGAGTACATGGACAAGCTCAAGGGCAAGTGCACCAGCCTCAACGACAACACGACGCTGGTGGAGATGGACC
CGGGGAGCTTCAAGACCTTCGACCTCGACTACTTCACCGTCGTGGCCAAGCGGAGGGGCCTCTTCCACTCCGACGGCGCCCTGCTCACCGACGACTTCACCCGCGCCTACGTGCAGCGCC
ACGCGGGCGGCGCCTTCAAGGAGGAGTTCTTCGCCGACTTCGCCGCGTCCATGATCAAGATGGGCAATGTCGACGTGCTCACCGGTACCCAGGGCGAGATCAGGAAGAAGTGCTCCGTGC
CTAATCATCATTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CAGTTCAAGC TTCTCACTGA TTAGCTAGCC ATCGGCGTCT CCTTGCCAAA GAAGAAGCAA TTAAGTTTCT TGGCTTCAAG ATGGCGTCGA GGGCTCTGAT GGTGGCGCTG CTGCTCGCGG  CGGTGGCCGT GGGGTGCGCG CGGGCGCAGC TGCGCGAGAA GTTCTACAGC GAGTCCTGCC CCAGCGTGGA GGAAGTCGTG AGGAAGGAGA TGATGAGGGC GCCTCGCAGC CTCGCCGCGC  CGATCCTCAG GATGCACTTC CACGACTGCT TCGTCCGGGG GTGCGACGGG TCGGTTCTGC TGGACTCGGC GAACAAGACG GCGGAGAAGG ACGGGCAGCC CAACCAGACC CTGCGCGGGT  TCGGCTTCGT CGATACGGTG AAGGCCGCCG TGGAGAAGGC GTGCCCCGAC ACCGTCTCCT GCGCCGACGT GCTCGCCCTC ATGGCCAGGG ACGCAGTCTG GCTGACCAAG GGGCCATTCT  GGGAAGTTCC TCTGGGCCGG CGAGACGGCA GCGTGTCCAT CTCCAACGAG ACCGACCAGC TCCCGCCCCC GACCTCCAAC TTCACCGTGC TGACCCAGCT CTTCGCCGCC AAGAACCTCG  ACGCCAAGGA CCTCGTCGTC CTCTCCGCCG GCCACACCAT CGGGACCTCG CACTGCGTCT CCTTCACCGA CCGCCTCTTC AACTTCACCG GCAGGGTCAA CCCCACCGAC GTCGACCCGA  CGCTCGACTC GGAGTACATG GACAAGCTCA AGGGCAAGTG CACCAGCCTC AACGACAACA CGACGCTGGT GGAGATGGAC CCGGGGAGCT TCAAGACCTT CGACCTCGAC TACTTCACCG  TCGTGGCCAA GCGGAGGGGC CTCTTCCACT CCGACGGCGC CCTGCTCACC GACGACTTCA CCCGCGCCTA CGTGCAGCGC CACGCGGGCG GCGCCTTCAA GGAGGAGTTC TTCGCCGACT  TCGCCGCGTC CATGATCAAG ATGGGCAATG TCGACGTGCT CACCGGTACC CAGGGCGAGA TCAGGAAGAA GTGCTCCGTG CCTAATCATC ATTAGTTAAC CTACGGGTTG ACGTACGTAC  GATGATTTTC ATTTGTGGCC ATCTTTTTTT TTTCATGTAC ATTACATCCT TTCTGCGCCC CCAATGTTTT TTGTTTATTT ATTGGTTATT TTGTTACATT ACGTCCATGT AAAGTATCTC 
CCAGAAATTC ACCGTGATAA TAAACTCTGT CTTTTCCCCC ATTGCCTCTG C 

Retrieve as FASTA