Entry information : BdiPrx109 (Bradi3g33780)
Entry ID 7875
Creation 2011-01-14 (Toky Ramarohetra)
Last sequence changes 2011-01-14 (Toky Ramarohetra)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-08 (Qiang Li)
Peroxidase information: BdiPrx109 (Bradi3g33780)
Name (synonym) BdiPrx109 (Bradi3g33780)
Class Class III peroxidase    [Orthogroup: Prx033]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Brachypodium
Organism Brachypodium distachyon    [TaxId: 15368 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BdiPrx109
start..stop
S start..stop
TaPrx220-1A 494 6.11e-178 20..323 25..327
TaPrx220-1D 493 8.96e-178 20..323 25..327
TaPrx220-1B 488 1.2e-175 20..323 25..327
ZmPrx142 477 3.86e-171 9..323 13..326
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '7875' 'join(36254788..36255006,36255102..36255281,36255395..36255557,36256348..36256757)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 36254788..36255006 217 N° 2 36255102..36255281 178 N° 3 36255395..36255557 161 N° 4 36256348..36256757 408
join(36254788..36255006,36255102..36255281,36255395..36255557,36256348..36256757 )


exon

Literature and cross-references BdiPrx109 (Bradi3g33780)
DNA ref. Phytozome 12:   Bd3 (36254788..36256757)
Protein sequence: BdiPrx109 (Bradi3g33780)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   323 (300)
PWM (Da):   %s   34568.97 (32278.9)  
PI (pH):   %s   4.95 (4.82) Peptide Signal:   %s   cut: 24 range:24-323
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MQAAGGRCAALLVLAWSAWCCGAQLAEKYYDGKCGNGTSVEAIIQ
GAVKARLAWDQRIVAGLLHMQFHDCFVE
GCDASLLLDGPSSEKTAPQNSGIFGFDFIDDVKSLLEAQCPGVVSCADIIIAATRDAVALCGGPSYSVQLGRLDGKSSAAWMCSDLPSPHIGIPKAIDVFAKKGFNAFEMVTLMGAHTVG
VTHCSVIMDRLFNFNGTGATDPSMDPGYAWVLKTFACPKGQPFDNIVYLDDPSSILTVDKSYFKQIFLGRGVLPVDQELRDDPTTGWMIKFFATTDFFNSMFGYALNKLAALDVKTGADG
EIRTNCRVTN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 3, 3 introns), no EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCAGGCTGCCGGCGGCCGGTGCGCGGCGCTTTTGGTGCTGGCTTGGTCGGCGTGGTGCTGCGGCGCGCAGCTGGCGGAGAAGTACTACGACGGCAAGTGCGGGAACGGGACGAGCGTG
GAGGCCATCATCCAGGGCGCCGTCAAGGCCCGCCTCGCCTGGGACCAGCGCATCGTCGCCGGGCTCCTCCACATGCAGTTCCACGACTGCTTCGTCGAA
AAGTAAGCAGTCTCCTTAATT
AATCTCGCCTAGCTAGTTTGCTCTCTTCCATTAATTCTTCTTTGATTGATTGATGTGTGCCGATATGATTTACCAGGGGTGCGACGCGTCGCTGCTGCTGGACGGGCCGAGCTCGGAGAA
GACGGCGCCGCAGAACAGCGGCATCTTCGGCTTCGACTTCATCGACGACGTCAAGTCCCTCCTCGAGGCGCAGTGCCCCGGAGTCGTCTCCTGCGCCGACATCATCATCGCCGCAACCAG
GGACGCCGTCGCTCTG
TGGTATTTCAATTTCATCCATCCATCTCCGTTGTCGCTGTCCGTCGATTATCTGTTCCGTTTGGACATGGAGACTGATCGGTTAACTGCATTGTGCGCGCGCAT
GACATTGGCAGTGTGGAGGGCCGAGCTACTCGGTGCAGCTGGGCAGGCTGGACGGCAAGTCGTCGGCGGCGTGGATGTGCAGCGACCTGCCGTCGCCGCACATCGGCATCCCCAAGGCCA
TTGACGTATTCGCCAAGAAGGGATTCAACGCCTTCGAGATGGTCACGCTCATGG
GGGTACGTACTACGTACTCCAACACCTCTGATCGATCAATATACAGTTAATTATATTAGTGGCAGG
CCTCGCGTAGCTTTGACCTAGAAACAGGGGCGTATTCAATCTCAATGTGCATCGACACACGGAATGTCACGTATTCCATAGCTGGCGCATATAAAAAAACATAGTATGACAGTTTGTATT
AGACTACTAGTACAAGTACGTAGCGAAGTGCATGTATATGTATGACTGATCGATATGATTGTAACTCAAATCACTAATCAAAGTATTCAAGTACCTAGTGAACAATATTCTATCCGGAAA
TATCCTGCTAGCTGTTGATTCAGATCTCATCGAGACACATTCGTAAGTGGGTAGAGCAGAAATCACTATGAGCCGTGAAAAAACAACAACTAGAGAAATCAAAATATAACTGGATGCTTA
GGGAGATCGGATGCTTAGGACATCTCCCATAGTTGCAAGGTATTGTTGGCATATTTATCATGTAAGTTTTTGTTAATGAGACAAATATTAAATGGAGATAGAGAGTAAGGTTGGTTAACA
TACAATTACGTAGTCCCTCCGATCAGTATTACTTTGTCTCAAATTTGTCCAAATACGAATGTATCTATGTATAAAAAACGTCTAGATACATGTAATATTTCGATAACTAATTCCGGCCGG
AGAAAGTACAAGATTCTAGGTGGGGCTTTTCATTAGACCACTAACTAAGATAGTCTATTGGGATGCTTGTATCATTTTTTGTTTGTTGTTTAACCGTTGGAGAGCACACGACGTCGATGC
ATGCAGGCGCGCACACGGTGGGGGTGACCCACTGCTCGGTGATTATGGACCGGCTATTCAACTTCAACGGCACGGGTGCGACAGACCCATCCATGGACCCGGGCTACGCGTGGGTCCTCA
AAACCTTCGCCTGTCCCAAGGGCCAGCCCTTCGACAACATCGTCTACCTCGATGACCCTTCCAGCATCCTCACCGTCGACAAGAGCTACTTCAAGCAGATCTTCCTCGGTCGCGGCGTGC
TCCCCGTTGACCAGGAGCTCCGCGACGACCCCACCACCGGCTGGATGATCAAGTTCTTCGCCACCACCGACTTCTTCAACTCCATGTTCGGCTACGCGCTCAACAAGCTCGCCGCCCTCG
ATGTCAAGACCGGCGCCGACGGCGAGATCAGGACCAACTGCCGCGTCACAAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCAGGCTGCCGGCGGCCGGTGCGCGGCGCTTTTGGTGCTGGCTTGGTCGGCGTGGTGCTGCGGCGCGCAGCTGGCGGAGAAGTACTACGACGGCAAGTGCGGGAACGGGACGAGCGTG
GAGGCCATCATCCAGGGCGCCGTCAAGGCCCGCCTCGCCTGGGACCAGCGCATCGTCGCCGGGCTCCTCCACATGCAGTTCCACGACTGCTTCGTCGAA
GGGTGCGACGCGTCGCTGCTG
CTGGACGGGCCGAGCTCGGAGAAGACGGCGCCGCAGAACAGCGGCATCTTCGGCTTCGACTTCATCGACGACGTCAAGTCCCTCCTCGAGGCGCAGTGCCCCGGAGTCGTCTCCTGCGCC
GACATCATCATCGCCGCAACCAGGGACGCCGTCGCTCTG
TGTGGAGGGCCGAGCTACTCGGTGCAGCTGGGCAGGCTGGACGGCAAGTCGTCGGCGGCGTGGATGTGCAGCGACCTGCCG
TCGCCGCACATCGGCATCCCCAAGGCCATTGACGTATTCGCCAAGAAGGGATTCAACGCCTTCGAGATGGTCACGCTCATGG
GCGCGCACACGGTGGGGGTGACCCACTGCTCGGTGATT
ATGGACCGGCTATTCAACTTCAACGGCACGGGTGCGACAGACCCATCCATGGACCCGGGCTACGCGTGGGTCCTCAAAACCTTCGCCTGTCCCAAGGGCCAGCCCTTCGACAACATCGTC
TACCTCGATGACCCTTCCAGCATCCTCACCGTCGACAAGAGCTACTTCAAGCAGATCTTCCTCGGTCGCGGCGTGCTCCCCGTTGACCAGGAGCTCCGCGACGACCCCACCACCGGCTGG
ATGATCAAGTTCTTCGCCACCACCGACTTCTTCAACTCCATGTTCGGCTACGCGCTCAACAAGCTCGCCGCCCTCGATGTCAAGACCGGCGCCGACGGCGAGATCAGGACCAACTGCCGC
GTCACAAACTGA

Retrieve as FASTA