Entry information : ZmPrx79(Zm00001d006933 / GRMZM2G044049)
Entry ID 789
Creation 2007-11-12 (Christophe Dunand)
Last sequence changes 2010-12-23 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2023-01-02 (Christophe Dunand)
Peroxidase information: ZmPrx79(Zm00001d006933 / GRMZM2G044049)
Name ZmPrx79(Zm00001d006933 / GRMZM2G044049)
Class Class III peroxidase    [Orthogroup: Prx111]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue types Seedlings
Silks
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrx79
start..stop
S start..stop
SbPrx43 540 0 69..368 66..364
SbPrx42 537 0 68..368 61..360
SiPrx143 504 1.19e-180 70..368 49..347
SiPrx119 491 1.79e-175 10..368 8..355
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '789' 'complement(join(212852517..212853278,212853374..212853718))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 212853374..212853718 343 N° 2 212852517..212853278 760  
complement(join(212852517..212853278,212853374..212853718))


exon

Literature and cross-references ZmPrx79(Zm00001d006933 / GRMZM2G044049)
Literature Qiu,F. et al., unpublished
DNA ref. GenBank:   AC193386.2 (99156..100337)
EST ref. GenBank:   BM078834 [3' end]
Cluster/Prediction ref. UniGene:   Zm.32932
Protein sequence: ZmPrx79(Zm00001d006933 / GRMZM2G044049)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   368 (343)
PWM (Da):   %s   39443.16 (36835.7)  
PI (pH):   %s   9.07 (9.07) Peptide Signal:   %s   cut: 31 range:26-368
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MQPSREMARLGVLVLVALLAADTTAQLAQAQGSSSSYGSAPPPPP
PTSPPSASPPAQTPPPAPTPPTPKLRYNFYKRSCPYAEDIIKQAVRNATNVNPGLGAGLIRMAFHDCFVR
GCDGSVLLDATPANPRPEKLGPPNFPSLRGYEVVDAAKAALEKACPGVVSCADVVQFAARDAVFFLSGSKVLYSLPGGRFDGRVSFENETLRFLPPPSFNLSQLVQSFKVKGMSVDDLVV
LSGSHTIGRSHCSSFSDRISTPPSDMNPALATVLKRQCPANPNFTNDPTVVQDIVTPDKLDNQYYWNVLRHNVLFKSDAALLTSTETARMVLENAGIRGRFERKFASAMLKMSLIEVKTA
ATGEIRKNCHVVN*

Retrieve as FASTA  
Remarks Complete sequence from 2 ESTs and genomic (chromo 2, intron 1). Cultivar="B73". FHDC is lacking in the DNA.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCAGCCATCACGAGAGATGGCTAGGCTTGGCGTCCTCGTCTTGGTTGCGCTTCTCGCCGCTGACACCACAGCTCAACTTGCTCAAGCGCAAGGGTCCTCCTCCTCCTACGGCAGTGCT
CCTCCTCCTCCTCCTCCAACTAGCCCGCCGAGCGCAAGCCCACCAGCCCAGACTCCACCACCGGCTCCTACTCCGCCAACGCCAAAGCTGAGGTACAACTTCTACAAGCGCTCGTGCCCT
TACGCCGAGGACATCATCAAGCAAGCCGTGAGGAACGCCACGAACGTCAACCCCGGCCTCGGCGCCGGCCTCATCCGCATGGCCTTCCACGACTGCTTCGTCCGG
GTACGTGAACCCCAA
TGCTAGCTGCCAAAATTTGTCCGTGCATGCATGCAATGCACGCGTGAGTGACCACACCACGTGTTTGTTGTTGTTTGCAGGGGGCTGCGACGGCTCCGTCCTGCTCGACGCGACGCCGGC
GAACCCGCGGCCGGAGAAGCTCGGCCCGCCAAACTTTCCTAGCCTGCGCGGCTACGAGGTGGTGGACGCGGCCAAGGCGGCGCTCGAGAAGGCCTGCCCGGGCGTCGTCTCCTGCGCCGA
CGTCGTCCAGTTCGCCGCTCGCGACGCCGTCTTCTTCCTCAGCGGCTCCAAGGTGCTCTACAGCCTCCCCGGGGGCCGCTTCGACGGCAGGGTGTCCTTCGAGAACGAGACGCTCAGGTT
CCTGCCGCCGCCGTCCTTCAACCTCTCCCAGCTCGTCCAGAGCTTCAAGGTCAAGGGCATGAGCGTCGACGACCTCGTCGTGCTCTCCGGCTCCCACACCATCGGCCGCTCCCACTGCTC
CTCCTTCTCCGACCGCATCTCCACGCCGCCCTCCGACATGAACCCTGCCCTCGCCACCGTGCTGAAGCGGCAGTGCCCGGCCAACCCCAACTTCACCAACGACCCCACGGTGGTGCAGGA
CATCGTCACCCCCGACAAGCTGGACAACCAGTACTACTGGAACGTGCTACGTCACAATGTGCTGTTCAAATCCGACGCGGCCCTGCTGACGTCGACGGAGACGGCGAGGATGGTGCTCGA
GAACGCCGGCATCCGAGGAAGGTTTGAGAGGAAGTTCGCCAGCGCGATGCTCAAGATGTCGCTCATCGAGGTCAAGACCGCTGCCACCGGCGAGATCAGGAAGAACTGCCACGTCGTCAA
TTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCAGCCATCACGAGAGATGGCTAGGCTTGGCGTCCTCGTCTTGGTTGCGCTTCTCGCCGCTGACACCACAGCTCAACTTGCTCAAGCGCAAGGGTCCTCCTCCTCCTACGGCAGTGCT
CCTCCTCCTCCTCCTCCAACTAGCCCGCCGAGCGCAAGCCCACCAGCCCAGACTCCACCACCGGCTCCTACTCCGCCAACGCCAAAGCTGAGGTACAACTTCTACAAGCGCTCGTGCCCT
TACGCCGAGGACATCATCAAGCAAGCCGTGAGGAACGCCACGAACGTCAACCCCGGCCTCGGCGCCGGCCTCATCCGCATGGCCTTCCACGACTGCTTCGTCCGG
GGCTGCGACGGCTCC
GTCCTGCTCGACGCGACGCCGGCGAACCCGCGGCCGGAGAAGCTCGGCCCGCCAAACTTTCCTAGCCTGCGCGGCTACGAGGTGGTGGACGCGGCCAAGGCGGCGCTCGAGAAGGCCTGC
CCGGGCGTCGTCTCCTGCGCCGACGTCGTCCAGTTCGCCGCTCGCGACGCCGTCTTCTTCCTCAGCGGCTCCAAGGTGCTCTACAGCCTCCCCGGGGGCCGCTTCGACGGCAGGGTGTCC
TTCGAGAACGAGACGCTCAGGTTCCTGCCGCCGCCGTCCTTCAACCTCTCCCAGCTCGTCCAGAGCTTCAAGGTCAAGGGCATGAGCGTCGACGACCTCGTCGTGCTCTCCGGCTCCCAC
ACCATCGGCCGCTCCCACTGCTCCTCCTTCTCCGACCGCATCTCCACGCCGCCCTCCGACATGAACCCTGCCCTCGCCACCGTGCTGAAGCGGCAGTGCCCGGCCAACCCCAACTTCACC
AACGACCCCACGGTGGTGCAGGACATCGTCACCCCCGACAAGCTGGACAACCAGTACTACTGGAACGTGCTACGTCACAATGTGCTGTTCAAATCCGACGCGGCCCTGCTGACGTCGACG
GAGACGGCGAGGATGGTGCTCGAGAACGCCGGCATCCGAGGAAGGTTTGAGAGGAAGTTCGCCAGCGCGATGCTCAAGATGTCGCTCATCGAGGTCAAGACCGCTGCCACCGGCGAGATC
AGGAAGAACTGCCACGTCGTCAATTAG

Retrieve as FASTA