Entry information : BdiPrx22 (Bradi1g33740)
Entry ID 7909
Creation 2011-01-17 (Toky Ramarohetra)
Last sequence changes 2011-01-17 (Toky Ramarohetra)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-08 (Qiang Li)
Peroxidase information: BdiPrx22 (Bradi1g33740)
Name (synonym) BdiPrx22 (Bradi1g33740)
Class Class III peroxidase    [Orthogroup: Prx130]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Brachypodium
Organism Brachypodium distachyon    [TaxId: 15368 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BdiPrx22
start..stop
S start..stop
HvPrx71 545 0 25..327 46..347
SiPrx27 539 0 24..327 21..325
OsPrx90 538 0 17..327 28..337
TaPrx54 531 0 25..327 43..344
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 29291280..29291489 210 N° 2 29291590..29291781 192 N° 3 29292837..29293002 166 N° 4 29293140..29293555 416
join(29291280..29291489,29291590..29291781,29292837..29293002,29293140..29293555 )


exon

Literature and cross-references BdiPrx22 (Bradi1g33740)
DNA ref. Phytozome 12:   Bd1 (29291280..29293555)
Protein sequence: BdiPrx22 (Bradi1g33740)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   327 (305)
PWM (Da):   %s   34389.48 (32424.4) Transmb domain:   %s   i2-24o
PI (pH):   %s   8.93 (9.06) Peptide Signal:   %s   cut: 23 range:23-327
Sequence 368
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLAAVVLGVVVLLATAAACAGAQQLSQSYYASTCPNVETLVRGAVTQKLQETFNAAPGTLRLFFHDCFVRGCDASVLISGPGDEHSAGPDTTLSPDALDLITRAKAAVDADARCSNKVSCADILALAARDVVSQAGGPYYQVELGRLDGKVGTRAAVKHSLPGAGFGLDQLNKLFAANGLTQTDMIALSGAHTMGVAHCANFVRRLYPFKGAAPRSNPAMNLYFLRQLRGTCPLNKYSPAAVAMLDAVTPMKFDNGYYQTLQQQKGLLASDQALFADRRSRPTVNHFAANQTAFFDAFAAAMAKLGRVGVKSGSSDGEIRRVCTKVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, 3 introns), no EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGCTGGCCGCGGTCGTGCTCGGCGTGGTGGTGCTGCTGGCGACGGCGGCGGCGTGCGCCGGGGCGCAGCAGCTGAGCCAGAGCTACTACGCGTCGACGTGCCCCAACGTGGAGACGCTCG
TCCGCGGCGCCGTCACCCAGAAGCTCCAGGAGACCTTCAACGCCGCGCCCGGCACGCTCCGCCTCTTCTTCCACGACTGCTTCGTCAGG
GTACGCATAGATCGAAAAAACCCCAGCTCAA
GCTTCCGTGCTGCAATTTTTACTCGTTTTTACAATCGGTTTTGAATTGAATCGATGAGTTTGTTTGCAGGGGTGCGACGCGTCGGTGCTGATCTCGGGGCCGGGGGACGAGCACAGCGCG
GGGCCGGACACGACGCTGTCGCCCGACGCGCTGGACCTCATCACGCGTGCCAAGGCCGCCGTCGACGCCGACGCGCGGTGCTCCAACAAGGTCTCCTGCGCCGACATCCTCGCCCTCGCC
GCCCGCGACGTCGTCTCCCAG
GTACACTTTGCCTTAGCCGCGGAAGAGCCGTTCGAGTAGTGCTCTAGCTGCTTCTGGTTGCTTGACGGCGACGCGTCTAAAACCTTAGTTAGTGCGGTT
TTTAGTCTCTAATAGTAGTAGTACTCCGTATTAAGTTTTTGAGCCGGTTTTCTAGTTCTGCTCTGCTCTAGACCTGCCCGTGGAGCGACAGCTATGATGATGGGGGCGCCGAGTTGACAA
GTCCCACGACCCACGGCGTGTGTGCGCACACTGGCCTTGTCCAGTTCTGCGCAGCCGTCCGGCACGACGAGCCCACGCTCGCTCTTCACGACCTGAGCTGTGAGAGCCTGTGGCGCAATT
ATGCCTCGCCCTGTGCCGGGAACACGTAAAAGCGTCACCGCTCAACAAACAACTAATCGTAGTATTATTACTGCGGAGTCGTCGACCAGTTAAATACGGCACCGAGGCAGGCAGTTAACA
AGAGAGACATCTCTTATTCCAGCAAGTTCGTAATCATTTCTTAGGCAAGTCGGCGACATTCTCCGTCCTTCGCTTTGCTTGTTTTGAGCAAGAACCTAATACCAGAAAGTTCGCATCTTT
TGGCGCTAAATTTTTGGAGATGGCCGGGCGTGGTCCATGTACGGGGCCAGCCGGTCGGGATTCCGCTTAGCTGCCGTATTTACTACTCATAGCAGCCTTCCGCTGCCCACAAAGGCCATT
GGCGCAGTTGGAGCCGAGCGTGAGACGGGAGCGAGAGTTATTACCACTGCACTGTCCTTGCCCGGCCAGCCGGCTTCAGTTCCCCCCGGAGTGCGTAGGAGTACTGGCAGTAGTATTACA
CGGCTCTTCAATGAACCGCGTGCAGCCCCTGTGGGCAAGACAGGGGCATGGTACATGGTAGCGGTAGAGCTACGGAATCCCCCATCAATTATTGGGTCGCGCAAGTTGGCCGTGTCCCGT
GTGTGTGCGTGCCCGGTTCCTCGATCGCAAACCGTGATGTAAATTCATGTGATTGTGCATTATTTTCAGGATTTTGAATTTTGTTTTGTTCTTTTGGTGGGTGCTTGTGCGTGCAGGCGG
GAGGGCCGTACTACCAGGTGGAGCTGGGGCGGCTGGACGGCAAGGTCGGGACGCGCGCCGCCGTGAAGCACAGCCTCCCGGGCGCCGGCTTCGGGCTGGACCAGCTCAACAAGCTCTTCG
CCGCCAACGGCCTCACCCAGACCGACATGATCGCGCTCTCAG
GTAGGAGTACCTAAAACGTCTCTCGGCCCAGAAGCCCGTTCGGTCCAGATCTCTACTAGTCCCCGGCAACATCACGCC
AAAAACATTCCGTCTGGGCCTGATTACAACTTGTTTTGGTGCACGTACGCATTTTTCAGGGGCGCACACGATGGGCGTGGCGCACTGCGCAAACTTCGTGCGGCGGCTGTACCCGTTCAA
GGGGGCGGCGCCGCGGAGCAACCCGGCGATGAACCTCTACTTCCTGCGGCAGCTGCGCGGGACGTGCCCGCTGAACAAGTACAGCCCGGCCGCGGTGGCGATGCTGGACGCCGTGACGCC
CATGAAGTTCGACAACGGCTACTACCAGACGCTGCAGCAGCAGAAGGGCCTGCTGGCCTCGGACCAGGCGCTCTTCGCCGACCGCCGGTCCAGGCCCACCGTCAACCACTTCGCCGCCAA
CCAGACCGCCTTCTTCGACGCCTTCGCCGCCGCCATGGCCAAGCTCGGCCGCGTCGGGGTCAAGTCCGGATCCTCCGACGGCGAGATCCGCCGGGTCTGCACCAAGGTCAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGCTGGCCGCGGTCGTGCTCGGCGTGGTGGTGCTGCTGGCGACGGCGGCGGCGTGCGCCGGGGCGCAGCAGCTGAGCCAGAGCTACTACGCGTCGACGTGCCCCAACGTGGAGACGCTCG
TCCGCGGCGCCGTCACCCAGAAGCTCCAGGAGACCTTCAACGCCGCGCCCGGCACGCTCCGCCTCTTCTTCCACGACTGCTTCGTCAGG
GGGTGCGACGCGTCGGTGCTGATCTCGGGGC
CGGGGGACGAGCACAGCGCGGGGCCGGACACGACGCTGTCGCCCGACGCGCTGGACCTCATCACGCGTGCCAAGGCCGCCGTCGACGCCGACGCGCGGTGCTCCAACAAGGTCTCCTGCG
CCGACATCCTCGCCCTCGCCGCCCGCGACGTCGTCTCCCAG
GCGGGAGGGCCGTACTACCAGGTGGAGCTGGGGCGGCTGGACGGCAAGGTCGGGACGCGCGCCGCCGTGAAGCACAGCC
TCCCGGGCGCCGGCTTCGGGCTGGACCAGCTCAACAAGCTCTTCGCCGCCAACGGCCTCACCCAGACCGACATGATCGCGCTCTCAG
GGGCGCACACGATGGGCGTGGCGCACTGCGCAA
ACTTCGTGCGGCGGCTGTACCCGTTCAAGGGGGCGGCGCCGCGGAGCAACCCGGCGATGAACCTCTACTTCCTGCGGCAGCTGCGCGGGACGTGCCCGCTGAACAAGTACAGCCCGGCCG
CGGTGGCGATGCTGGACGCCGTGACGCCCATGAAGTTCGACAACGGCTACTACCAGACGCTGCAGCAGCAGAAGGGCCTGCTGGCCTCGGACCAGGCGCTCTTCGCCGACCGCCGGTCCA
GGCCCACCGTCAACCACTTCGCCGCCAACCAGACCGCCTTCTTCGACGCCTTCGCCGCCGCCATGGCCAAGCTCGGCCGCGTCGGGGTCAAGTCCGGATCCTCCGACGGCGAGATCCGCC
GGGTCTGCACCAAGGTCAACTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GCGGTGGCGG CGGCAGAGCC AGAGCCAGAG CATGCTGGCC GCGGTCGTGC TCGGCGTGGT GGTGCTGCTG GCGACGGCGG CGGCGTGCGC CGGGGCGCAG CAGCTGAGCC AGAGCTACTA  CGCGTCGACG TGCCCCAACG TGGAGACGCT CGTCCGCGGC GCCGTCACCC AGAAGCTCCA GGAGACCTTC AACGCCGCGC CCGGCACGCT CCGCCTCTTC TTCCACGACT GCTTCGTCAG  GGGGTGCGAC GCGTCGGTGC TGATCTCGGG GCCGGGGGAC GAGCACAGCG CGGGGCCGGA CACGACGCTG TCGCCCGACG CGCTGGACCT CATCACGCGT GCCAAGGCCG CCGTCGACGC  CGACGCGCGG TGCTCCAACA AGGTCTCCTG CGCCGACATC CTCGCCCTCG CCGCCCGCGA CGTCGTCTCC CAGGCGGGAG GGCCGTACTA CCAGGTGGAG CTGGGGCGGC TGGACGGCAA  GGTCGGGACG CGCGCCGCCG TGAAGCACAG CCTCCCGGGC GCCGGCTTCG GGCTGGACCA GCTCAACAAG CTCTTCGCCG CCAACGGCCT CACCCAGACC GACATGATCG CGCTCTCAGG  GGCGCACACG ATGGGCGTGG CGCACTGCGC AAACTTCGTG CGGCGGCTGT ACCCGTTCAA GGGGGCGGCG CCGCGGAGCA ACCCGGCGAT GAACCTCTAC TTCCTGCGGC AGCTGCGCGG  GACGTGCCCG CTGAACAAGT ACAGCCCGGC CGCGGTGGCG ATGCTGGACG CCGTGACGCC CATGAAGTTC GACAACGGCT ACTACCAGAC GCTGCAGCAG CAGAAGGGCC TGCTGGCCTC  GGACCAGGCG CTCTTCGCCG ACCGCCGGTC CAGGCCCACC GTCAACCACT TCGCCGCCAA CCAGACCGCC TTCTTCGACG CCTTCGCCGC CGCCATGGCC AAGCTCGGCC GCGTCGGGGT  CAAGTCCGGA TCCTCCGACG GCGAGATCCG CCGGGTCTGC ACCAAGGTCA ACTGATCTAT TGCCATTGCT GATGCCAGGA TAGAGGACGT ACGTACATTC AGTAGAGAGA GGGTAAATCG  GTCAATTGTG TGTCTCTCCT CATCTTCTTC TTCTTCTCCG TTGCCTTGCC TTGCTCCGGC CCCCCACATG CTTCCCACCA GTGCATTCAT TCATCGCAGC GAATTCGTTC GCGCCCGATT  CTTTCTCTTC ACCGTGTAAT AATCGTACAG GCGCCATCAA TACCTTAGGG CCTACCAGTA CCATGTGATG GATCGATAGG AACAAACACT TACAGGTTAC ATCCATGTAA ATCTTACACT  TGGTCCGGTT AAGAAGCAAG TATATCCCAT ATGAAGTTAT TTTTTGAAGA AGAATATCCA TGTAAGAGTA GATGTGTATG GTGTTGAATC TGTCCACTGT ATGTATTCTG TTGCCTTGTG 
GTGGATCCAG ACTGGCGCCA GAGGATTCAA CATGCTTGGT CCAAGGTGAG TTGAACACCA GCCAGAAAAA CATGTGAAAT TTTCAGTCAA ACTAACAGCC AAGCACACCT TCGGT 

Retrieve as FASTA