Entry information : ZmPrx83
Entry ID 793
Creation 2007-11-16 (Christophe Dunand)
Last sequence changes 2007-11-16 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-01-31 (Qiang Li)
Peroxidase information: ZmPrx83
Name ZmPrx83
Class Class III peroxidase    [Orthogroup: Prx147]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue type Roots
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrx83
start..stop
S start..stop
ZmPrx19 639 0 4..348 3..339
SbPrx91 609 0 45..348 45..348
SiPrx12 607 0 1..348 1..344
OsPrx54 550 0 37..348 35..344
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 116117378..116117845 468 N° 2 116117123..116117288 166 N° 3 116116613..116117025 413  
complement(join(116116613..116117025,116117123..116117288,116117378..116117845))


exon

Literature and cross-references ZmPrx83
Literature Walbot,V., unpublished.
DNA ref. GenBank:   AC198511.3 (32036..33265)
Protein sequence: ZmPrx83
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   348 (321)
PWM (Da):   %s   37212.51 (34416.0) Transmb domain:   %s   i12-31o
PI (pH):   %s   7.54 (6.98) Peptide Signal:   %s   cut: 28 range:28-348
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MARRQQWSRGGLAAVAVLAVLCVLCSGHPVPGGHGSGGGGFVNTLQPHFYDHACPQMQAIVGSVVAKAHAEDPRMAASLLRMHFHDCFVQGCDASVLLDADGSGRFVTEKRSNPNKDSLRGFEVIDEIKAALEHACPRTVSCADIVAVAARDSVVLTGGPGWEVPLGRRDSLTASLSGSNNLIPAPNDSLPTIIGKFANQGLDIVDLVALSGGHTIGDSRCVSFRQRLYGQNNNGQVDRTLNPAYAAELRGRCPRSGGDQNLFALDPASQFRFDNQYYHNILAMDGLLSSDEILLTQSRQTMGLVHRYAADQGLFFDHFAKSMVKMGNISPLTGSAGEIRHNCRRVNH

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 10, intron 2 and 3) and 9 ESTs. Cultivar="B73", "W23".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCACGGCGACAACAGTGGAGCAGGGGCGGCCTCGCGGCCGTGGCGGTGCTCGCCGTGCTGTGCGTGCTCTGCTCGGGCCACCCGGTGCCGGGCGGGCATGGCAGCGGCGGCGGCGGG
TTCGTCAACACGCTGCAGCCGCACTTCTACGACCACGCGTGCCCGCAGATGCAGGCCATCGTGGGCTCCGTCGTTGCGAAGGCGCACGCGGAGGACCCGCGCATGGCGGCGTCGCTGCTG
CGGATGCACTTCCACGACTGCTTCGTGCAGGGGTGCGACGCCTCCGTGCTGCTGGACGCCGACGGCAGCGGCAGGTTCGTCACCGAGAAGCGCTCCAACCCCAACAAGGACTCGCTCCGC
GGGTTCGAGGTCATCGACGAGATCAAGGCCGCGCTGGAGCACGCCTGCCCGCGCACCGTCTCCTGCGCCGACATCGTCGCCGTCGCCGCGAGGGACTCCGTCGTCCTG
GTACGTACCAAG
CAGCTAATGCAGAGCAATAATGGTTTATTTATGTATGTATGTATGGAACATAGCTAATTGCATGCGCTGCACCACAGACCGGCGGACCCGGCTGGGAGGTGCCACTGGGGAGGAGGGACT
CGCTGACGGCCAGCCTGAGCGGCTCGAACAACCTCATCCCTGCTCCCAACGACTCTCTCCCCACCATCATCGGCAAGTTCGCCAACCAAGGCCTCGACATCGTCGACCTCGTCGCACTTT
CAG
GTACGTACGTATACACAGTAGACATGCACGTGCGTGCGTGCGTGCATGCGCGTTCCATCAGTTGCAGTTCCTTCAACGATCGAACAACTGAGTGCAGGAGGGCACACCATCGGCGAC
TCGCGCTGCGTGAGCTTCCGGCAGCGGCTGTACGGGCAGAACAACAACGGGCAGGTGGACCGGACGCTGAACCCGGCGTACGCGGCGGAGCTGCGGGGGCGGTGCCCGCGGTCGGGCGGC
GACCAGAACCTGTTCGCGCTGGACCCGGCGAGCCAGTTCCGGTTCGACAACCAGTACTACCACAACATCCTGGCCATGGACGGGCTGCTCAGCTCCGACGAGATCCTGCTCACGCAGAGC
CGCCAGACCATGGGCCTCGTCCACCGCTACGCCGCCGACCAGGGGCTCTTCTTCGACCACTTCGCCAAGTCCATGGTCAAGATGGGCAACATCTCGCCGCTCACCGGGAGCGCCGGCGAG
ATCAGGCACAACTGCAGGAGGGTCAACCACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCACGGCGACAACAGTGGAGCAGGGGCGGCCTCGCGGCCGTGGCGGTGCTCGCCGTGCTGTGCGTGCTCTGCTCGGGCCACCCGGTGCCGGGCGGGCATGGCAGCGGCGGCGGCGGG
TTCGTCAACACGCTGCAGCCGCACTTCTACGACCACGCGTGCCCGCAGATGCAGGCCATCGTGGGCTCCGTCGTTGCGAAGGCGCACGCGGAGGACCCGCGCATGGCGGCGTCGCTGCTG
CGGATGCACTTCCACGACTGCTTCGTGCAGGGGTGCGACGCCTCCGTGCTGCTGGACGCCGACGGCAGCGGCAGGTTCGTCACCGAGAAGCGCTCCAACCCCAACAAGGACTCGCTCCGC
GGGTTCGAGGTCATCGACGAGATCAAGGCCGCGCTGGAGCACGCCTGCCCGCGCACCGTCTCCTGCGCCGACATCGTCGCCGTCGCCGCGAGGGACTCCGTCGTCCTG
ACCGGCGGACCC
GGCTGGGAGGTGCCACTGGGGAGGAGGGACTCGCTGACGGCCAGCCTGAGCGGCTCGAACAACCTCATCCCTGCTCCCAACGACTCTCTCCCCACCATCATCGGCAAGTTCGCCAACCAA
GGCCTCGACATCGTCGACCTCGTCGCACTTTCAG
GAGGGCACACCATCGGCGACTCGCGCTGCGTGAGCTTCCGGCAGCGGCTGTACGGGCAGAACAACAACGGGCAGGTGGACCGGACG
CTGAACCCGGCGTACGCGGCGGAGCTGCGGGGGCGGTGCCCGCGGTCGGGCGGCGACCAGAACCTGTTCGCGCTGGACCCGGCGAGCCAGTTCCGGTTCGACAACCAGTACTACCACAAC
ATCCTGGCCATGGACGGGCTGCTCAGCTCCGACGAGATCCTGCTCACGCAGAGCCGCCAGACCATGGGCCTCGTCCACCGCTACGCCGCCGACCAGGGGCTCTTCTTCGACCACTTCGCC
AAGTCCATGGTCAAGATGGGCAACATCTCGCCGCTCACCGGGAGCGCCGGCGAGATCAGGCACAACTGCAGGAGGGTCAACCACTAG

Retrieve as FASTA