Entry information : BdiPrx131(Bradi5g19857)
Entry ID 7931
Creation 2011-01-18 (Toky Ramarohetra)
Last sequence changes 2014-01-08 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2023-01-18 (Christophe Dunand)
Peroxidase information: BdiPrx131(Bradi5g19857)
Name BdiPrx131(Bradi5g19857)
Class Class III peroxidase    [Orthogroup: Prx045]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Brachypodium
Organism Brachypodium distachyon    [TaxId: 15368 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BdiPrx131
start..stop
S start..stop
HvPrx13 509 0 1..319 4..321
TaPrx133-1A 501 0 2..319 5..321
TaPrx58-1A 499 1.9e-180 5..319 4..317
HvPrx15 498 8.17e-180 1..319 4..321
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '7931' 'join(22777116..22777322,22777421..22777612,22777772..22778335)https://peroxibase.toulouse.inra.fr/CI4/display_perox/edit_perox/7931#ProteinDNA' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 22777116..22777322 205 N° 2 22777421..22777612 190 N° 3 22777772..22778335https://peroxibase.toulouse.inra.fr/CI4/display_perox/edit_perox/7931#ProteinDNA 562  
join(22777116..22777322,22777421..22777612,22777772..22778335)https://peroxibase .toulouse.inra.fr/CI4/display_perox/edit_perox/7931#ProteinDNA


exon

Literature and cross-references BdiPrx131(Bradi5g19857)
DNA ref. Phytozome 12:   Bd5 (22776958..22778335)
Protein sequence: BdiPrx131(Bradi5g19857)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   319 (297)
PWM (Da):   %s   33973.04 (31609.8) Transmb domain:   %s   i7-29o (i7-29o)
PI (pH):   %s   6.23 (5.64) Peptide Signal:   %s   cut: 23 range:23-319
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ASSCRIWHCLLALFLISSAAYGQLSPTFYAASCPGLQLVVSSTVNSAILAERRMGASLLRLHFHDCFVQGCDGSILLDDVGSFVGEKTAGPNKNSVRGYDVIDRIKQTLEQMCPGVVSCA
DIVALAARDGRLQLGGPTWEVLLGRRDSTTTSLADANTDLPAPTSNLDVLISAFAKKNLSPRDLTALSGAHTVGFSQCSNFRDHIYNDTNIDTAFAALRKTDCPAAAPAGNTNLSPLDVE
TQADVFDNAYYRNLVARRGLLHSDQELFNGASQDALVRQYGNNPALFASDFVTAMIKMGSISPLTGATGEIRLNCRVVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 5, intron 1 and 2). Incorrect prediction from phytozome ( large part of the exon 1 is missing but no start codon found upstream!!!). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GCTTCCAGCTGCAGGATCTGGCATTGCCTGCTTGCCCTCTTCCTCATCTCCTCCGCCGCATATGGGCAGCTCTCGCCGACATTCTATGCCGCAAGCTGCCCGGGGCTGCAGTTGGTCGTG
AGCAGCACCGTGAACTCGGCCATCCTCGCTGAGCGCCGCATGGGCGCCTCCCTCCTCAGGCTCCACTTTCATGACTGCTTCGTCCAA
AAGTAATATTTGAGCCATTAGTTCTTAACAAAA
CATACCTATTTTTATTGGTAATGAAGCCAGGATTGATGATGAACATCATATGTTTATTGTTACGTAGGGCTGTGACGGATCCATTCTTCTGGACGACGTGGGGAGCTTCGTCGGTGAGAA
GACCGCTGGCCCGAACAAGAACTCTGTGCGCGGCTACGACGTCATTGACCGGATTAAGCAGACCCTGGAGCAAATGTGCCCTGGCGTCGTCTCCTGCGCCGACATCGTCGCCCTTGCTGC
ACGGGACAGCACATTTCTG
TGGTACATACATACCTTGAACATGTGTTTATTGTATGGTTTTTCCGAAAAGGAGGAGAATTCGAAAACCTCTCGACCTCTTCATGCACTGTTTACTGTAAA
TACTAGATATTCCAATACTGGCAACCCTGAGTTCGTACATATTCGATTGGTCGTTTGCAGCTCGGCGGGCCCACTTGGGAGGTCTTGCTCGGCCGACGCGACTCGACGACAACGAGCTTG
GCCGACGCGAACACCGACCTCCCAGCACCGACGTCGAACCTCGACGTGCTCATCAGCGCGTTCGCCAAGAAGAACCTGAGCCCGCGGGACCTGACGGCGCTCTCCGGCGCGCACACCGTC
GGCTTCTCGCAGTGCTCCAACTTCCGCGACCACATCTACAACGACACCAACATCGACACCGCCTTCGCCGCGCTGCGCAAGACCGATTGCCCGGCCGCAGCCCCCGCCGGCAACACGAAC
CTCTCTCCGCTCGACGTAGAGACGCAGGCCGACGTCTTCGACAACGCCTACTACCGCAACCTGGTGGCCCGGCGCGGACTGCTGCACTCGGACCAGGAGCTCTTCAACGGCGCCTCCCAG
GACGCGCTGGTGCGGCAGTACGGCAACAACCCGGCATTGTTCGCCTCTGACTTCGTCACGGCGATGATCAAAATGGGGAGCATAAGCCCGCTCACCGGAGCCACGGGCGAGATCAGGCTC
AACTGCAGGGTCGTCAACGGCTGA

Retrieve as FASTA