1. Browse the Database
  2. View Redoxidase
Entry information : SbPrx[P]08
Entry ID 7932
Creation 2011-01-19 (Toky Ramarohetra)
Last sequence changes 2014-08-05 (Christophe Dunand)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2014-08-05 (Christophe Dunand)
Peroxidase information: SbPrx[P]08
Name SbPrx[P]08
Class Class III peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SbPrx[P]08
start..stop		 S start..stop
OsPrx125 224 5.5e-74 1..176 99..283
ZmPrx34 217 3.32e-71 2..176 101..284
SiPrx152 212 3.95e-69 1..176 99..283
SiPrx149 210 2.09e-68 1..176 101..289
Gene structure Fichier Exons►


exon

Literature and cross-references SbPrx[P]08
DNA ref. Phytozome 12:   chromosome_1 (47036011..47039797)
Protein sequence: SbPrx[P]08
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   176
PWM (Da):   %s   19059.16  
PI (pH):   %s   4.72
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
PPNNKSARGFPAVDAAKAALEDACPAVVSCESAIAAEISVELLGGPSWGVLLGRLDSKTSDYNGSLNHTAPTDNLTIFSYVQQPQPQRCRPCRPFSECQSVVNRLYNFSNTGLLDPTMDF
ANLEFLSQRCPRNGNGSALNDVDPTTPDTFHTNHYYTNIEVNRGFLNSDQELKSSP

Retrieve as FASTA  
Remarks Pseudogene from genomic (chromo 1). Part of exon 2, 3 and 4 including several frame shift.
DNA ►
Send to BLAST
CDS►
Send to BLAST