Entry information : ScomAPx-CcP01
Entry ID 7938
Creation 2011-01-21 (Marcel Zamocky)
Last sequence changes 2011-01-21 (Marcel Zamocky)
Sequence status complete
Reviewer Nizar Fawal
Last annotation changes 2012-04-03 (Catherine Mathe (Scipio))
Peroxidase information: ScomAPx-CcP01
Name ScomAPx-CcP01
Class Hybrid Ascorbate-Cytochrome C peroxidase    [Orthogroup: APx-CcP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Schizophyllaceae Schizophyllum
Organism Schizophyllum commune    [TaxId: 5334 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ScomAPx-CcP01
start..stop
S start..stop
AdelAPx-CcP 442 3.04e-151 11..524 12..514
ParcAPx-CcP02 440 3.4e-150 11..498 14..509
ParcAPx-CcP01 424 1.01e-143 9..498 11..507
DsAPx-CcP 410 1.37e-138 2..468 5..475
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '7938' 'join(672436..672657,672709..672801,672849..672915,672963..673008,673062..673343,673396..673509,673568..673748,673808..674146,674203..674445)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 672436..672657 220 N° 2 672709..672801 91 N° 3 672849..672915 65 N° 4 672963..673008 44
N° 5 673062..673343 280 N° 6 673396..673509 112 N° 7 673568..673748 179 N° 8 673808..674146 337
N° 9 674203..674445 241  
join(672436..672657,672709..672801,672849..672915,672963..673008,673062..673343, 673396..673509,673568..673748,673808..674146,674203..674445)


exon

Literature and cross-references ScomAPx-CcP01
Literature Ohm R.A., de Jong J.F., Lugones L.G., Aerts A. et al. (2010) Genome sequence of the model mushroom Schizophyllum commune. Nat. Biotechnol. 28: 957-963.
Protein ref. UniProtKB:   D8QH59
DNA ref. JGI genome:   scaffold_11 (672436..674445)
Protein sequence: ScomAPx-CcP01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   529 (512)
PWM (Da):   %s   57143.56 (55283.5)  
PI (pH):   %s   4.34 (4.28) Peptide Signal:   %s   cut: 18 range:18-529
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MISRLFISLAIARVAFAYTWPSPKLDRLEAMRWDQLGYNSFEPAL
FVTPCDRYIHPTEKGYEGVRSNAGDWIRT
AYHDMATHNKDDGTGGMDASIRLWEEQARAENPGTHFNNSVVFVAGAVDRHFSLADGLALLLVMAVENCGGPEIDYRGGRIDATEPNNAGVPEPDQDLDSHEAAFARQGFTSEEMIGLVA
CGHSIGSVQHADFPDQVPESPNGTDYISGVSFDGSLVNFDNT
IATEYIEGTTQNPLVVGLNETKNSDARIFSLDGNQTMSAFAKDADHFASTCASLLARMIDTVPKGVELTEVIKPLPVK
PSQLKLTYSKSGNITLSGEV
RLFDVSENDARVVQLAWTDSTCTGDDCEVHRVKMAHTANMTGSAQAKRYTTLWYGNTAGLADIDPAKGFGGFWFEVDEGDGNAVKKAQDGAGFALPTDKI
MLAEGTCEKTINV
AVHESVKPSRVYIAGDAFTSDNQAQAPANEFDMKAAGDADANGYVIYTVELDAMPSFGWGILAEVDGKTIELPQNERSDFC

Retrieve as FASTA  
Remarks Complete sequence from genomic, 8 introns, no EST found. Strain="H4-8".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATTTCGCGCTTATTTATCTCCCTCGCCATCGCGCGCGTCGCTTTTGCTTATACCTGGCCTTCGCCAAAGCTCGACAGGTTGGAGGCTATGCGATGGGACCAGCTGGGGTATAACTCG
TTCGAGCCTGCTCTGTTCGTGACCCCCTGCGATCGGTACATCCACCCGACGGAGAAGGGGTACGAGGGCGTGCGCTCGAATGCCGGAGACTGGATACGCACG
CGGTGCGTCTGACGTCGG
TGGCCCGAGATTCCATCCTGACACTCTCACGGTAGGCATACCATGACATGGCCACACATAACAAAGATGACGGTACGGGTGGTATGGACGCCTCCATTCGTCTTTGGGAGGAGCAAGCTC
GGGCGGAG
AGGTGAGCGACACTTGCAATCAATAAGATCTCCGACCAACTGTCTTCAGAACCCTGGCACGCACTTTAACAACAGTGTCGTGTTCGTTGCGGGTGCTGTTGACCGTCATTTT
TCCC
CCGTATGTTCCATGCATTTTCTGACGATCGTGACTAATGAGATGGTCAGTGGCGGACGGCCTTGCTCTGTTGCTCGTGATGGCCGTCGAGAACTGTGGTGCGTTTCGCATCACCGG
AGAGCCGTATTTTATTATCTGACGCGCGTTACAGCGGCGGACCCGAGATCGACTACCGCGGTGGCCGCATCGATGCCACCGAGCCCAACAACGCGGGCGTCCCCGAGCCCGACCAGGACC
TCGACAGTCATGAAGCGGCCTTCGCCCGTCAGGGATTTACATCCGAGGAGATGATTGGTCTCGTCGCGTGCGGGCACTCGATTGGGAGTGTGCAGCACGCCGACTTCCCCGACCAGGTTC
CGGAGTCGCCCAATGGGACGGACTACATTTCGGGTGTATCCTTCGATGGGTCGCTGGTTAACTTTGACAACACGAT
ATGTGAGTGGTGGTAGATTTAAAGCTCGGAACGTGTACTGATAT
CTCCACGCAGAGCCACAGAGTACATCGAGGGCACGACACAGAACCCACTTGTCGTCGGTCTGAACGAGACGAAGAATTCGGATGCAAGGATATTCAGCCTTGACGGAAACCAGACGATGT
CTGC
GCGTGAGTACCTCCTATCAAATCTGCACCGTCAGCAGTGGGATTGACTATGATATCTTAGCTTCGCGAAGGATGCCGACCACTTTGCTTCTACATGCGCATCCCTGCTTGCTCGCA
TGATCGATACTGTCCCTAAGGGTGTGGAGCTCACCGAAGTCATCAAGCCCTTGCCGGTAAAGCCCTCCCAACTCAAGCTTACCTATTCCAAGAGCGGCAACATTACCCTCTCCGGTGAAG
TCAGG
GGGTACGTCCTTCACCCAACCCTCCTTCCCTTTCGTCACCCTGACTAACGCCCACCTCCAGCTTTTTGACGTCTCCGAGAACGACGCGCGTGTCGTCCAGCTCGCATGGACCGAC
TCCACCTGCACGGGCGACGACTGCGAGGTGCACCGCGTCAAAATGGCGCACACCGCGAACATGACCGGCTCCGCGCAGGCCAAGCGCTACACCACGCTCTGGTACGGGAACACGGCCGGC
CTCGCCGACATCGACCCCGCGAAGGGCTTCGGCGGCTTCTGGTTCGAGGTCGACGAGGGCGACGGCAACGCGGTAAAGAAGGCCCAGGACGGCGCGGGCTTCGCGCTCCCGACGGACAAG
ATCATGCTTGCGGAGGGGACGTGCGAGAAGACGATCAATGTCGCG
CGGTCAGTGAAGATGGGTCTAGCAAGCAGGGCAGCGGTGCTGATGATTGCTCGCACAGGTCCACGAGAGCGTCAA
GCCGAGCCGCGTGTACATCGCAGGCGACGCGTTCACAAGCGACAATCAGGCGCAGGCCCCTGCGAACGAATTCGACATGAAGGCCGCGGGCGACGCCGATGCCAACGGTTATGTTATCTA
CACCGTCGAGCTTGACGCCATGCCGTCATTCGGCTGGGGTATCCTCGCCGAGGTCGACGGCAAGACAATCGAGCTGCCGCAGAACGAGCGCAGCGACTTCTGCTCG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATTTCGCGCTTATTTATCTCCCTCGCCATCGCGCGCGTCGCTTTTGCTTATACCTGGCCTTCGCCAAAGCTCGACAGGTTGGAGGCTATGCGATGGGACCAGCTGGGGTATAACTCG
TTCGAGCCTGCTCTGTTCGTGACCCCCTGCGATCGGTACATCCACCCGACGGAGAAGGGGTACGAGGGCGTGCGCTCGAATGCCGGAGACTGGATACGCACG
GCATACCATGACATGGCC
ACACATAACAAAGATGACGGTACGGGTGGTATGGACGCCTCCATTCGTCTTTGGGAGGAGCAAGCTCGGGCGGAG
AACCCTGGCACGCACTTTAACAACAGTGTCGTGTTCGTTGCGGGT
GCTGTTGACCGTCATTTTTCCC
TGGCGGACGGCCTTGCTCTGTTGCTCGTGATGGCCGTCGAGAACTGCGGCGGACCCGAGATCGACTACCGCGGTGGCCGCATCGATGCCACCGAGCCC
AACAACGCGGGCGTCCCCGAGCCCGACCAGGACCTCGACAGTCATGAAGCGGCCTTCGCCCGTCAGGGATTTACATCCGAGGAGATGATTGGTCTCGTCGCGTGCGGGCACTCGATTGGG
AGTGTGCAGCACGCCGACTTCCCCGACCAGGTTCCGGAGTCGCCCAATGGGACGGACTACATTTCGGGTGTATCCTTCGATGGGTCGCTGGTTAACTTTGACAACACGAT
AGCCACAGAG
TACATCGAGGGCACGACACAGAACCCACTTGTCGTCGGTCTGAACGAGACGAAGAATTCGGATGCAAGGATATTCAGCCTTGACGGAAACCAGACGATGTCTGC
CTTCGCGAAGGATGCC
GACCACTTTGCTTCTACATGCGCATCCCTGCTTGCTCGCATGATCGATACTGTCCCTAAGGGTGTGGAGCTCACCGAAGTCATCAAGCCCTTGCCGGTAAAGCCCTCCCAACTCAAGCTT
ACCTATTCCAAGAGCGGCAACATTACCCTCTCCGGTGAAGTCAGG
CTTTTTGACGTCTCCGAGAACGACGCGCGTGTCGTCCAGCTCGCATGGACCGACTCCACCTGCACGGGCGACGAC
TGCGAGGTGCACCGCGTCAAAATGGCGCACACCGCGAACATGACCGGCTCCGCGCAGGCCAAGCGCTACACCACGCTCTGGTACGGGAACACGGCCGGCCTCGCCGACATCGACCCCGCG
AAGGGCTTCGGCGGCTTCTGGTTCGAGGTCGACGAGGGCGACGGCAACGCGGTAAAGAAGGCCCAGGACGGCGCGGGCTTCGCGCTCCCGACGGACAAGATCATGCTTGCGGAGGGGACG
TGCGAGAAGACGATCAATGTCGCG
GTCCACGAGAGCGTCAAGCCGAGCCGCGTGTACATCGCAGGCGACGCGTTCACAAGCGACAATCAGGCGCAGGCCCCTGCGAACGAATTCGACATG
AAGGCCGCGGGCGACGCCGATGCCAACGGTTATGTTATCTACACCGTCGAGCTTGACGCCATGCCGTCATTCGGCTGGGGTATCCTCGCCGAGGTCGACGGCAAGACAATCGAGCTGCCG
CAGAACGAGCGCAGCGACTTCTGCTCG

Retrieve as FASTA