1. Browse the Database
  2. View Redoxidase
Entry information : ZmPrx145(Zm00001d029279 / GRMZM2G168073)
Entry ID 7940
Creation 2011-01-25 (Christophe Dunand)
Last sequence changes 2011-01-25 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2023-01-09 (Christophe Dunand)
Peroxidase information: ZmPrx145(Zm00001d029279 / GRMZM2G168073)
Name ZmPrx145(Zm00001d029279 / GRMZM2G168073)
Class Class III peroxidase    [Orthogroup: Prx143]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue type Seedlings
Inducer Salt stress
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrx145
start..stop		 S start..stop
ZmPrx[P]110 669 0 1..336 1..336
ZmPrx144 663 0 1..336 1..337
SbPrx15 605 0 2..336 3..332
SiPrx155 547 0 1..336 1..320
Gene structure Fichier Exons►


exon

Literature and cross-references ZmPrx145(Zm00001d029279 / GRMZM2G168073)
EST ref. GenBank:   AI649415.1 [Fragment]
Protein sequence: ZmPrx145(Zm00001d029279 / GRMZM2G168073)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   336 (310)
PWM (Da):   %s   35160.69 (32627.4) Transmb domain:   %s   i7-29o (i7-29o)
PI (pH):   %s   7.36 (7.05) Peptide Signal:   %s   cut: 27 range:27-336
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASKMPAALLSCAFLLLGAVFQAAAGHYSPPSPASCGLKVGYYDH
KCPPAEAIVKSVVRAAVRRNPGIGAGLIRMLFHDCFVEGCDASVLLDPTPANPQPEKLGPPNNPSLRGFEVIDAAKAAVERACPGVVSCADIVAFAARDASSFLGGRRVDFDMPAGRLDGRASNASRTLDFLPPPTSSLPELVQSFAAKGLSAEDMVA
LSGAHTVGRSHCSSFVPDRLAVPSDISASFAASLRGQCPASPSSSNDPTVVQDVVTPDKLDNQYYKNVLAHRVLFTSDASLLTSPATAKLVDDNANVPGWWEDSFKVAMVKMASVEVKTG
NSGEIRRNCRLVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, intron 1) and 1 EST. Cultivar="B73".
DNA ►
Send to BLAST
CDS►
Send to BLAST