Entry information : PpaPrx53
Entry ID 7944
Creation 2011-01-27 (Toky Ramarohetra)
Last sequence changes 2012-01-05 (Christophe Dunand)
Sequence status complete
Reviewer Catherine Mathe
Last annotation changes 2012-08-22 (Catherine Mathe)
Peroxidase information: PpaPrx53
Name PpaPrx53
Class Class III peroxidase    [Orthogroup: Prx063]
Taxonomy Eukaryota Viridiplantae Streptophyta Funariaceae Physcomitrella
Organism Physcomitrella patens    [TaxId: 3218 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpaPrx53
start..stop
S start..stop
PpaPrx13 692 0 1..336 1..336
PpaPrx43 585 0 1..336 1..335
PpaPrx[P]13 482 2.17e-173 1..336 1..308
PpaPrx07 337 9.57e-116 12..335 8..324
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '7944' 'join(45619..45870,46068..46253,46416..46988)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 45619..45870 250 N° 2 46068..46253 184 N° 3 46416..46988 571  
join(45619..45870,46068..46253,46416..46988)


exon

Literature and cross-references PpaPrx53
DNA ref. Phytozome 12:   scaffold_219 (45619..46988)
Protein sequence: PpaPrx53
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   336 (304)
PWM (Da):   %s   35733.8 (32378.1)  
PI (pH):   %s   6.26 (7.24) Peptide Signal:   %s   cut: 33 range:33-336
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAFDPMGASKLQVLLMTVAVAMFFLSGEVEANSYNLRPNYYSGK
CGKYDVESIIYNEIAKAFQQDNGVAPGLVRMAFHDCFVR
GCDASLLLDIPNSEKTATINLGLRASAFNAIDAAKTAVESVCPGVVSCADVLQYATRDSVLLTKGKGWTVYGGRRDGTVSNAADPPNNLPVPTMTPTQMIPLFAGKGLSADDLVALSGSH
TIGIAHCIFVNPRIYGNNTDPTIPADFLASLKSQCPADSVTTNPPVGAPINLDRVSPTKFDSQYFQNIIDRKGLLTSDQSLLDDSRTRGAVYKNSGNFFNSEFGRAMQAMAGIGVLTGNE
GQIRTNCRAVNP*

Retrieve as FASTA  
Remarks Complete sequence from genomic (intron 1 and 2). Tandem duplication of PpaPrx13 or misassembly!!)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGCTTTCGATCCGATGGGTGCATCAAAACTGCAAGTTTTGCTGATGACAGTGGCTGTTGCCATGTTTTTCTTGAGCGGCGAGGTGGAAGCTAATTCGTACAACCTTCGACCAAAT
TATTACTCGGGCAAGTGCGGCAAATATGATGTAGAATCGATAATCTACAATGAGATTGCCAAGGCATTTCAACAGGACAATGGAGTCGCCCCCGGCCTTGTGAGGATGGCCTTCCATGAT
TGTTTCGTTCGT
GTGTAAGTGTGGACTCTCCTTCGTCGTGCGACTTCGTCCAGTGCTTGTAATTTGTGTAGGCTTCGCCAATGTGCTTGCGTCTTGGCGAGTTTACGGGCACACGTTTTG
AGGATCAAGTCATGTCTGTGATGGTGTGCTTTTGCACCGAAATTACTTCGGACTGTGAGGATGCATCTGAAGTTGGATGTTGCTCTTCCAGGGCTGTGACGCCTCATTGCTGCTTGACAT
ACCCAATTCTGAGAAGACTGCAACCATCAACCTAGGTCTTCGGGCGAGCGCTTTCAACGCAATCGACGCTGCCAAAACCGCCGTGGAGAGTGTGTGTCCAGGGGTCGTTTCCTGTGCTGA
CGTTCTACAATACGCTACTCGCGACTCTGTGCTGCTG
TGGTGCTGCTCACTTGACCCTGAATCGATTATGTCACCACTGATTGATCATCTGTGGACAACATCTCTGTATCTTTAGTTCAT
GCTTCCTTGGAAAGATTTCCCTTGAATCTCAGAACTTCCAGACGACCTCTCATGTTGAAGTCATTTGTATGTTGATTGCAGACCAAAGGTAAAGGCTGGACTGTGTATGGCGGTCGAAGA
GACGGAACTGTGTCCAACGCTGCCGACCCCCCCAACAACCTACCAGTGCCAACGATGACGCCAACTCAGATGATTCCTCTCTTCGCAGGCAAGGGATTGAGCGCCGATGATTTGGTGGCT
TTGTCGGGCAGTCACACCATCGGAATTGCTCACTGCATTTTCGTGAACCCTCGCATCTACGGGAACAACACCGATCCTACGATTCCAGCCGACTTCTTGGCGTCGTTGAAGAGTCAGTGC
CCAGCGGATTCTGTCACTACTAACCCGCCCGTTGGAGCCCCGATCAACCTGGACCGGGTTTCACCTACCAAGTTCGACTCGCAGTATTTCCAGAACATTATCGACAGGAAGGGCTTGCTC
ACATCCGACCAAAGCCTGCTGGACGATTCCAGAACCAGAGGAGCCGTGTACAAGAACAGCGGAAATTTCTTCAATTCGGAATTCGGAAGGGCCATGCAAGCCATGGCTGGAATCGGTGTA
CTCACTGGCAATGAAGGCCAAATCCGCACGAATTGTCGCGCCGTTAACCCTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGCTTTCGATCCGATGGGTGCATCAAAACTGCAAGTTTTGCTGATGACAGTGGCTGTTGCCATGTTTTTCTTGAGCGGCGAGGTGGAAGCTAATTCGTACAACCTTCGACCAAAT
TATTACTCGGGCAAGTGCGGCAAATATGATGTAGAATCGATAATCTACAATGAGATTGCCAAGGCATTTCAACAGGACAATGGAGTCGCCCCCGGCCTTGTGAGGATGGCCTTCCATGAT
TGTTTCGTTCGT
GGCTGTGACGCCTCATTGCTGCTTGACATACCCAATTCTGAGAAGACTGCAACCATCAACCTAGGTCTTCGGGCGAGCGCTTTCAACGCAATCGACGCTGCCAAAACC
GCCGTGGAGAGTGTGTGTCCAGGGGTCGTTTCCTGTGCTGACGTTCTACAATACGCTACTCGCGACTCTGTGCTGCTG
ACCAAAGGTAAAGGCTGGACTGTGTATGGCGGTCGAAGAGAC
GGAACTGTGTCCAACGCTGCCGACCCCCCCAACAACCTACCAGTGCCAACGATGACGCCAACTCAGATGATTCCTCTCTTCGCAGGCAAGGGATTGAGCGCCGATGATTTGGTGGCTTTG
TCGGGCAGTCACACCATCGGAATTGCTCACTGCATTTTCGTGAACCCTCGCATCTACGGGAACAACACCGATCCTACGATTCCAGCCGACTTCTTGGCGTCGTTGAAGAGTCAGTGCCCA
GCGGATTCTGTCACTACTAACCCGCCCGTTGGAGCCCCGATCAACCTGGACCGGGTTTCACCTACCAAGTTCGACTCGCAGTATTTCCAGAACATTATCGACAGGAAGGGCTTGCTCACA
TCCGACCAAAGCCTGCTGGACGATTCCAGAACCAGAGGAGCCGTGTACAAGAACAGCGGAAATTTCTTCAATTCGGAATTCGGAAGGGCCATGCAAGCCATGGCTGGAATCGGTGTACTC
ACTGGCAATGAAGGCCAAATCCGCACGAATTGTCGCGCCGTTAACCCTTAG

Retrieve as FASTA