Entry information : BdiPrx[P]127 (Bradi5g00690)
Entry ID 7951
Creation 2011-01-28 (Christophe Dunand)
Last sequence changes 2011-01-28 (Christophe Dunand)
Sequence status theoretical translation / pseudogene
Reviewer Qiang Li
Last annotation changes 2014-01-08 (Qiang Li)
Peroxidase information: BdiPrx[P]127 (Bradi5g00690)
Name (synonym) BdiPrx[P]127 (Bradi5g00690)
Class Class III peroxidase     [Orthogroup: Prx100]*
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Brachypodium
Organism Brachypodium distachyon    [TaxId: 15368 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BdiPrx[P]127
start..stop
S start..stop
BdiPrx128 350 9e-123 1..215 55..328
SiPrx12 317 7e-110 1..215 67..341
ZmPrx19 315 4e-109 1..215 62..336
ZmPrx83 315 4e-109 1..215 71..345
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 628902..628958 57 N° 2 628968..628982 15 N° 3 636068..636233 166 N° 4 636534..636940 407
join(628902..628958,628968..628982,636068..636233,636534..636940)


exon

Literature and cross-references BdiPrx[P]127 (Bradi5g00690)
DNA ref. Phytozome 12:   Bd5 (628902..636940)
Protein sequence: BdiPrx[P]127 (Bradi5g00690)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   215
PWM (Da):   %s   23576  
PI (pH):   %s   10
Sequence 256
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
KDPRMAASLLRLHFHDCFVTVSCATGGPGWKVPLGRKDSQNASLSGSSKLIPAPNDTLSTITTKFHNQGLNIVDLVTPSGAHTIGDARCVSFRQRLYNQNDDGWRRPDPTLNPVYAAKLKGRCPRSGGDQNLFALDPVGQFRFDNQYYKNILALKGLLSSDEALLTQSHETMKLVKSYAANNGLFFQQFAKSMVKMGNISPLTGFNGEIRKNCRR

Retrieve as FASTA  
Remarks Pseudogene from genomic (chromo 5). PS and exon 2 are missing (sequence contains "n").
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AGGACCCGCGCATGGCGGCGTCCCTGCTCCGGCTGCACTTCCACGACTGCTTCGTGCCCGAGGCGACCGTCTCCTGCGCCGCTCCTGGTATGCACCGTCCAAAACAAACCAACACTAACC
AAGTTTAGCCAAAAATCTTCCGATCCAAGTTAGTTTTATTGAATAAGTCATGATATATATAAATCTTCGTGGCATACATATTTGATATCGTAGATACTAGTATTTTTTTTTTCGGAACAC
GTTCGCTACAACAAAAACATGCCTGTAGAGACGCCCAATTAGCAGACTAAAGACGTGATATTTCATCTCTATTGAATTATAGAGTCGCTTTCACAAAGCGTCCTTGAAGCGTCTCCTCAG
GGACCGTGTCAAGTTATGTAGAGACGCTAGCTAAGCGTGCCTATAACATATAAGATGCTTTGTAGAGACGTTGAAACTCGTGTCTATACATGTAGGGACGTTTTATTTGACACGTTTCAC
TCACATCCCTACTAATAGTTTGACACGCTCAATTTACGTTACAACAAATATAGAGACGCTTTTACAAATTTGGACTAGCCCATCTCGTGAGGTAGTATTGGGTTGGTTTGTTTGTTTTTT
GAAAGGGTACTGGGTTGGGTTTTAGGCCCACCATTCTGCCGGCTACAAATTTGGCTAGTATTGGGTTGGGTTTTTTTGAAAGAGTACTGGGTTGGGTTTCAGGTCCACCATTCTGCCAGC
CCAACTTAATTTAGAATTCATTGCACGGGCCCAGCCCATTTACGGAAAAAATATTTTTCTGCATAATATTTTAAATTACAAATCTTCTAGGAAAACGCCATTTTCTGTTTAAATTCGGAA
TTGTTATTTTCTTAATTTTGATGACGCACGTTCGCACAATAAGTTGTACGAAGACAGGAGTATATGATCTGCATCGTTTCATGACCTTGTTCACACTTAGTTGTGCAAAAACAAAGTACA
TAATCTAAATGTTCATTTCATATATGACCATATTCTCATAACAAGACTAACTAATACTAGAGCTTTGAATTGACTGCAGCAACAAATATGTTACAATAAATGGAGTTCACAAATCACAGC
TGAATTAAACTTTCGTGTAGATAAGTTGCAATACATAGAGAAAAGCTCTTATTTGCACATATGTTTTGGTTCTAAATAATTGTATATCTATAAGCTTTGCTCTAACAGAAACTTAATCTT
TTTTGCTTATCCCTCTGTCCAATATGTCTCTTGGCCTCAACCATCCTGCAAAGTATGCAGATAAAATGAATACTCCTTGAAAATATAAGCTCTCCTGGGAGTTTAGAATGACATGTTTAA
TTTTCTGACGAAATTAGAATACCTTGTTGTTTGTCAGCTGGTTTGGAGTCGTTCTCTTAGCTTTTTTGACCTGTAAATCACAACATGTGTTCATAAATAACAATGTTCCCAATCAGACAT
TTGTGTATACTTTGTGAATACCGAGTTGTTCCAGAATGAAAATACTTACATGTGACCGAGGCCAAGCAATAACATAACCAATAGCATCTTGTAGCATTTGAGAATTTTCATATGGCCTAG
GCAATCTTTCGTTTCCAGTTTTTGTGACAGCGAAAACCGAAACTGCATAATATTCATCTCCAAGCATGTTTCCTCCAACGACGTATGTTTTATCTTTACTCACTAAAGATCCTTTGGCAA
CCATTTTATTTTTGTTTCTTGGGTTTGCCGAAACAAGAAGACTTCACTTTTACCCTACCATTCCAAGAAATAAAACATAGTTATTCATAAAGCATATTTAATTTAAAAAAGTTACAGTAA
CACATACTGACATGGACGAACTATTATGATACTTGTCCAATTGACAAAACATTTAGAAGAGGACATTTGAGTGCATAATAGTTTATATATAGTATCACTTGTACGAAATAATGCATACAC
ATCCCTTTTGATCCATAGTTTTTGCGTGTCTGGTGTAATCAATTTCGTACAACTCTGATTTGCCTTGTCACATTTTTCAATATGCGCTTCCTACAATTGATTCAGTTTAGTTGTAAGAAA
GCTTATAAAAAAATTGAATGGCTTGGTAGATAAGTACAAATTACTGCACACATCTTTTCCACCATGTATTCATCTGGTAAAGTAAAATTGGTGTGACCCACTTTGGTTTTTGTACAGTTG
CTAGGATGCAGTCCCCGCAACTTACGATGAACAATTGATTTTAACATTGGCAACAACTAGTAAAAAAGAACGCATCTAGTGTTGAGAGATAAAAAAACAACACGACATCAAAATAAAAGA
CTACAAACATCACCTGCACAGTGTTTGGTGGAGCATGAGTATCACAATTTGATTCTTCAACTTCATGTTCTGATTCATGTGGGATGTCACTGGCAGCATCTCTTTCATAGAGAGCATCCT
GAAATGAGAACATGGTCAAAGTACACTGATACAGAACAATTTATATTTGTAGAAATAGAGATGGGGTTCAAATACTAACTTCATCATTTTCTGTAGTTACAGCTGCATTTCTCCAATCTT
CACCAGGATTTTTTTTTGAAATAAATGTACGCATGAGAATCATCTCATCTCTCATGTCTTCCACATTATCTTCAACTGCCCGTAGTGCAAATCGAACCTCTTTGTCTTGCTCAGGTTGCT
GAACAAAAGTCAATCCCCGAGAAACCTTTACCCCACTCCAATACTTATAATTATAGTAACCTCAAAATTGTGACTCTTTTCCATACACCCTTTTAAACACTTCTCTATAATCTTCCAATA
AAAGACTCCCATTGTTATCTGTTTTCCTTTTTGCTAATTCCTCCTATTGAAGTAAACATAAACATCTCATTAAACAATGTAGATACTATGATTAAAATTGAAGTGTTTATTTTTGCCATA
TGTAGTAGTATACCATTAGTATCTTTGTATTCTCGTTACTGTAATTTCCATTCTTCTTCTTGTGAGCTTCATCCCAAAGGTCAATCTTGGGAACCTTTGCTTTCCTAATGATTTCCTGTG
AAAAAAAAGCAGAGTACAATATTTATAAAGTTTCATGTTAAAAGTAAAAAATTCAGTTTGCCAAGTAACACAACACATGGAGAGGATAAAACATCACCATCACATTTAGGAGCCTAGCAT
GACTTTTTCTCCCTGTTGTGTGTGAATTCTTTTGATTCTTTGCACATTGGGAGTTCTTTTCACATAATTTCTAGAAAAAATAGATTCAGTCAATAATAATGCAAGCAAACTAGCTATGGA
TTTTAGTTCAAGTATGAGACAATGGATACATCACCGTGTGTGAATCCTGGCACCACAGTCCAATAAGAGTATCCCATTGAAGTTTATTAACACCTTTTGGAACATCTGCCATAATTGCAT
CTAATGTCCTCTCGTGCCGGCTGTAATATTTTTTCTTCAAACGAGATTTGTAGGCTCTCCATCTTTTGCTAATAGTCATTAGGATCCAGTCCCTTGTAAGCTGCTTTGTGTCATGAGGGT
AGACAAATTTCTCCTTAAACAAGTAACTTGGTTGTTAGCATATGAAATGAACATACTGATTCAAGGAATAGTGCTATGAAAATTGTACCTCCACATCATTGATCATGTTCTGATGTTTTG
ACAGAAACAATTCATTATCCCATCTCAGAATGTGCAGCGGTGCAAATGTTGAGTTCTCTGCTAGACTGCCAAGGTGCTGACTAAGAATGGTAGCTGACCGTTGATTTGGAATACCATTTT
CATCAGTTTCCACGATTATTTTTCCTCCCTTTAAGGCCGGAAATTTTTTAACTCGAAATTCCCCTAAAATTTGACACGCCTCTCCATTTGGCCCTGCATATAAGAATATCACACTGGTGC
ACAACTGGTGGAAAATTACACTAAGAATGTATATGAAACATTATTTTTTAGCTTACAAATTATCTTAATTTGGCCAGTAGACTCAGGAGGCCTCTGTCGTAACATATCGTCAATCTCTGG
AGGACCTTGTAAATTTCTTTCACCAGATTCCACATTTTCTGCATCCTCTAATGGAATATTCAAGTTTCGTAGCCGTCTAGGTAGCCTCGCCACAATATCTTCACTAAAGCAATGCAAAGA
ACAGATCTCAGGCAACAATCTAATGCTAGATAATTATGTGCATAAGCAAAGATCCTATGATCTGCTTGTTTAGAACTATTTACGTACTGCAATCTCAAGTTCAGGAATAATAGTCAGCCC
ATTACTTGTAAGCACAAGATCCTACAGTATAGTCATGCATTTAGGAGTCCTTGTATGTCATGCGTTCTTCGCTACCGCCTCCTGCAACAGAATTTGTTGGAACACCAGGAATATGCGAAC
TGATGTTATCTTCTACGCGTGCAAATGCAAATGACGGCTCATTATAATCCTCTCCATGGCAAACCCATTTAATGTAACCCGGAAGAATACCATCACACCTCAGGTGGGTTTTAACTTCAT
CATAATTTTGTGTTCTTCTATTTCGACACTTCACGCATGGACAGAGGATTTTTTTCATCATGTGGAACATCACGAAAGGCAAAAGATAGGAATTGCTCAACACCATCTTTATAAGCAGCA
CTTGTTCTTGGTTTACTCATCCAACCTCGATCCATCACTCTTTGATATGCTGCAGTAATTAACACAAAATAGATCAGTTTGTCATTAATTGTCTGATGTCTATTTCTACATATGGTACAT
TCATGCAGCTATTGATTAACAAGTTTTAAGTTGGAGGTATCTTAATTCTTTTGAGATTTAGCATAATATATCTTCCGTGTTGAGCTGTCCATGGGTGTGAATGATCAGTAATGAAATTCC
AAATTATCGCGCTACAAATTTTTTGAACACAATATTTGATGGTACAACTACTAAGGTACTCAACAGTGTTAATTTTTCTAAACAAACAACACAGAACAACAACGCAGCTAAGTTGGCGGC
ATTTTCTGCACAAGTCAAAAGTACCTCGGTAATCTACTCTATAATATGTTCAATGTGCTCTGTCACACATGGCTCACAAGTAGGAGGTAACCACTGCAGCTCAGCCATGTCAACAAGAAA
CTCGTTTATGAATCAGGTACTCGACACCAAATTTATATATAAAAAAAACAAATTTGGGGGAGAGAGAGAGAGAGGGGGGGGCTACCGATTGGGGATTTCAGCCCGACGATGGACTTGAAG
ATTGAACAGCACCACAGTCAAATTGAAGATTGGAGAAATTTGGGGAATGGGCCAGTCGGAGGAGACGACGAGTGGGCGACGGGTGACTGCCGGACGGCGATTCTGTGCTGCCACGCTAGG
CCGACGGCGGACGTGAATCCTTGACCTAGCGGGCGGGGCCAACGGGAGCCAGGGAGTTGGATAATGGAGGAGGCGTGTGGCTGGGTGGAGGCGGGCGGCGGGCAGCACTGCGGCACAACC
GTGCAGTGGCCGGCAGCGTTGCGTTGCGCTTCCGCTTTCTCTCGATCTCCCGTCCCCGATTCAGTTTGCTCCCGCGAATCTGGTGCGCTCTTATTGAGGGGCCGAGCTGGGCCTGGTGCT
ATTCGGGCTGTAGCACCGGTCCAGCAAAATAGGATAAAACAACAGACAAAAATAAAGAAATGAGGCCAGTCAAGATTTGTTAGCCCATTAGCACCAGCAGACCCATGGAAGCACCACCCA
GCCCAGGGAGCAGCAGGCCTGCTCGAAGCCAAGCCTGAGAAGCGCATGAGCAGTCCTTCGCATGACAGCAGTCGATCGATCCTGAAGCTTCATATCTTCTATGAAAAGGAATGTTTTGCT
CAAAAAAATGAAAAGATATATCAGTTAAAACACGAACACAAAAACACTTCTGTCATGTTGGCTATCAACCTTTCAGATGTTTTTAACTTCTCGGTTGAGCGTTCGAATTTGGAACACGCA
AGTATTTAACAGATTTAATTACTTTGATTAGCAAAGATTAATAGTCATTATAGTGTCTCAAATTTCATCTCTATCTTAAATGTAATTTTTTTTATCAATTACTTAGAAAAGATTAAGAAT
TATCTTATATACCGTCTCAAATTCATCTCTACCTTGAACGTAAATATTTTTTTAATCAATTCCTAAGAAAAGATTAAGAGTCATCTTATATAGCGTCTCAAATATCGTCTATATGTTAAA
TATAAATGTATTTTTTAATCAATTCCTAATTTACAAGAGATTATTGTGACGTTGTGTAAAGCGTTTCAAAAAGCGTCTTTACTTAGCGTTCATCATTTGGTGTTGAGACGAAATGCATTG
GCGTCTTAAAAAAACGACTCTACATGCATGTTTTGTTGTAGTGTTCGGTTGCTCCCGACTAATCCCAACCCTCACTCACCTCGAGATTCATGCAAAATACATGACAGAGAGAGCAGCGCA
CATGACCGCCACCACTGCCAGACAGTGGGACCATACGGTGGGTAGAGAGAGAGAGGAGGGGGGGTACTGCCACGCCAATGGCGGACCGAATTCAAGGTTAATTAGTGACGGTGGACGCCC
GGCCACTGACCTCGCACCACTGGTGCTCCAGACCTCCAGTGGCGGGTATGACCACTGCCACTGGTGTTGTACCAGCACTAGAGAGAGAGAAGGGGGGGGGGGGGAGGGGGCGACCCCTGC
CGCCATATGGCCGGCTGAGTGGTGAAGAGAGAGACGATGGGGCGACCCCCACTACCATATAGCCGGCCGCGTGGTGGAGAGAGAGGGATGCAGGGAAGAGCAAACGGGGATGAAGGTGGG
TGGCGCGTGGAGGGAGAGAGAGAGAGCGGGGAGGGGGGGGGCAGCCTGGTGGAGGGGGAGAAAGAGCGACCGGTCCGCATCGTGGAGGGGGGTGACGGCAGTGGAGGGGGGCGGGACGAC
GACACTGGGAAGAGATAGAAGGTAACGGCGCTGGGGGGTGCTGGGGAGGAGACGGACAGGATCCAAGGAAATATGCGGCCAGGATAGGTGCGTGCAATGCACCCGGGAATAACAAATCCA
CCCTCTTTTCTATAACCATGGTCATAGTTTTAAAAGTTTGACATAGTACAAAATAAAACCATTTTGTAAGTGTTGACTGGTCGTTAATTTTCCCTATGTTCGTTTTCTTTTCACAACATT
TTTTTAGCGCAAAATCGCCATTGGCCCGTATCGAATGTACCCTTTCTTAAAAATTTATCCTACCTTGATGAACACAACCGAGCAGACGGGTGGACCAGGCTGGAAGGTGCCACTGGGGAG
GAAGGACTCGCAAAACGCCAGCTTGAGCGGCTCCAGCAAGCTCATCCCTGCTCCAAATGACACTCTCTCCACCATCACCACCAAGTTCCACAACCAGGGTCTCAACATCGTCGACCTCGT
CACGCCCTCAG
GTTATTACAAGAATTAACACATTAATTTACTTCTTCAATTCCTTCTTGTCTAAAAAGAGAGCATACATAAATACTACTCCCCCCTTTCCTAATTATAAGAAGTTCTAAC
TTTGTCTACACATTATTATAAGAAGTAAAGCATATATTATACTATGAAAATATATATAATGACACATTTAATAAAACTAATTTGGAGTTTTATATGTCGCATAGATTTCTTTTTAGACTT
TAAACTTGGTCAAGGACTTCTTATATGGAAAAACTGAGGCAGTGACATAGATCAACATACACACAATGCAGGGGCACACACCATCGGCGACGCACGCTGCGTGAGCTTCCGGCAGCGGCT
GTACAACCAAAACGACGACGGGTGGCGCCGCCCCGACCCAACGCTGAACCCGGTGTACGCCGCGAAGCTGAAGGGCCGGTGCCCGCGGTCCGGCGGCGACCAGAACCTATTCGCACTCGA
CCCTGTCGGCCAGTTCCGGTTCGACAACCAGTACTACAAAAACATCTTAGCCTTGAAAGGCTTGCTCAGCTCCGACGAGGCCCTGCTGACGCAGAGCCACGAGACCATGAAGCTTGTCAA
GAGCTACGCCGCCAACAATGGTCTCTTCTTCCAGCAGTTCGCCAAGTCCATGGTCAAGATGGGCAACATCTCGCCGCTGACGGGGTTCAACGGCGAGATCAGAAAGAACTGCAGGAGG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AGGACCCGCGCATGGCGGCGTCCCTGCTCCGGCTGCACTTCCACGACTGCTTCGTGACCGTCTCCTGCGCCACGGGTGGACCAGGCTGGAAGGTGCCACTGGGGAGGAAGGACTCGCAAA
ACGCCAGCTTGAGCGGCTCCAGCAAGCTCATCCCTGCTCCAAATGACACTCTCTCCACCATCACCACCAAGTTCCACAACCAGGGTCTCAACATCGTCGACCTCGTCACGCCCTCAG
GGG
CACACACCATCGGCGACGCACGCTGCGTGAGCTTCCGGCAGCGGCTGTACAACCAAAACGACGACGGGTGGCGCCGCCCCGACCCAACGCTGAACCCGGTGTACGCCGCGAAGCTGAAGG
GCCGGTGCCCGCGGTCCGGCGGCGACCAGAACCTATTCGCACTCGACCCTGTCGGCCAGTTCCGGTTCGACAACCAGTACTACAAAAACATCTTAGCCTTGAAAGGCTTGCTCAGCTCCG
ACGAGGCCCTGCTGACGCAGAGCCACGAGACCATGAAGCTTGTCAAGAGCTACGCCGCCAACAATGGTCTCTTCTTCCAGCAGTTCGCCAAGTCCATGGTCAAGATGGGCAACATCTCGC
CGCTGACGGGGTTCAACGGCGAGATCAGAAAGAACTGCAGGAGG

Retrieve as FASTA