Entry information : SmPrx[P]52b_1
Entry ID 7963
Creation 2011-02-02 (Toky Ramarohetra)
Last sequence changes 2011-02-17 (Christophe Dunand)
Sequence status theoretical translation / pseudogene
Reviewer Toky Ramarohetra
Last annotation changes 2011-02-17 (Toky Ramarohetra)
Peroxidase information: SmPrx[P]52b_1
Name SmPrx[P]52b_1
Class Class III peroxidase     [Orthogroup: Prx006]*
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrx[P]52b_1
start..stop
S start..stop
SmPrx[P]55b_1 441 4e-160 1..225 1..229
SmPrx[P]54b_1 441 4e-160 1..225 1..229
SmPrx[P]51b_1 437 8e-159 1..225 1..229
SmPrx[P]54a_16 424 3e-153 1..225 1..251
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2625304..2625649 346 N° 2 2625726..2625928 203 N° 3 2625932..2626057 126  
join(2625304..2625649,2625726..2625928,2625932..2626057)


exon

Literature and cross-references SmPrx[P]52b_1
DNA ref. Phytozome 12:   scaffold_1 (2625304..2626057)
Protein sequence: SmPrx[P]52b_1
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   224
PWM (Da):   %s   24207.38  
PI (pH):   %s   8.12
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GCDASILLDSKGSIKSERDSDKNFGIRRLDFINRIMEAACPGVVSCADIIVLVARESIVFTGGPTIPMLTGRRDSTAASNAAADRLLPPATVSVDNFISLFASKGLSLDESVAIIGAHTIGVGHCVNIVNRLYPNQDSKISLLFASRLRVQCPTANPWMLNNITVINNDMTNLVFDNQYFRDARFSTNQ*LFLDTFSSAFVKLTSSNVLTGQSGQVRKYCHSVN

Retrieve as FASTA  
Remarks Pseudogene. Exon 1 is missing and stop codon in frame.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GGTTGCGACGCGTCCATCTTGCTCGACTCGAAAGGTTCCATCAAAAGCGAAAGAGACTCGGACAAGAACTTTGGCATCCGCCGCTTGGATTTCATCAACAGGATCATGGAGGCCGCCTGT
CCGGGAGTCGTCTCGTGCGCGGACATCATCGTTCTGGTGGCCAGAGAATCCATCGTCTTCACCGGAGGCCCGACAATCCCCATGCTCACAGGAAGAAGAGACAGCACAGCCGCTTCCAAC
GCCGCAGCCGACAGGCTGTTGCCTCCAGCAACCGTAAGCGTCGACAACTTCATCAGCCTCTTCGCATCCAAGGGCCTCTCTCTCGACGAAAGCGTTGCAATCATCG
GTACGTCTCAAGGC
TTTTCTTTCCAGCAAACTTTCCAAGGACAATTGATCCGAACTTCTGTACTTTTGCATTCCAGGAGCTCACACAATTGGAGTCGGGCACTGTGTCAACATTGTGAATCGGCTCTATCCAAA
CCAGGACAGTAAGATCAGTCTCCTGTTTGCGAGCCGGCTGAGAGTCCAGTGCCCGACGGCCAATCCCTGGATGCTCAACAACATTACAGTGATCAACAACGATATGACCAACCTCGTCTT
TGACAACCAGTACTTCCGGGACCTT
ATAGCGCGCTTCTCCACGAACCAGTAGCTCTTCCTCGACACATTCTCTTCAGCTTTCGTCAAGCTCACGTCCAGCAATGTCTTGACAGGACAGAG
TGGACAGGTTCGAAAGTACTGCCACTCAGTGAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GGTTGCGACGCGTCCATCTTGCTCGACTCGAAAGGTTCCATCAAAAGCGAAAGAGACTCGGACAAGAACTTTGGCATCCGCCGCTTGGATTTCATCAACAGGATCATGGAGGCCGCCTGT
CCGGGAGTCGTCTCGTGCGCGGACATCATCGTTCTGGTGGCCAGAGAATCCATCGTCTTCACCGGAGGCCCGACAATCCCCATGCTCACAGGAAGAAGAGACAGCACAGCCGCTTCCAAC
GCCGCAGCCGACAGGCTGTTGCCTCCAGCAACCGTAAGCGTCGACAACTTCATCAGCCTCTTCGCATCCAAGGGCCTCTCTCTCGACGAAAGCGTTGCAATCATCG
GAGCTCACACAATT
GGAGTCGGGCACTGTGTCAACATTGTGAATCGGCTCTATCCAAACCAGGACAGTAAGATCAGTCTCCTGTTTGCGAGCCGGCTGAGAGTCCAGTGCCCGACGGCCAATCCCTGGATGCTC
AACAACATTACAGTGATCAACAACGATATGACCAACCTCGTCTTTGACAACCAGTACTTCCGGGACCTT
GCGCGCTTCTCCACGAACCAGTAGCTCTTCCTCGACACATTCTCTTCAGCT
TTCGTCAAGCTCACGTCCAGCAATGTCTTGACAGGACAGAGTGGACAGGTTCGAAAGTACTGCCACTCAGTGAAC

Retrieve as FASTA