Entry information : SmPrx[P]17b10_8
Entry ID 7983
Creation 2011-02-07 (Toky Ramarohetra)
Last sequence changes 2011-02-07 (Toky Ramarohetra)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2011-08-12 (Christophe Dunand)
Peroxidase information: SmPrx[P]17b10_8
Name SmPrx[P]17b10_8
Class Class III peroxidase     [Orthogroup: Prx027]*
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrx[P]17b10_8
start..stop
S start..stop
SmPrx17-1_0 386 5.17e-136 98..283 138..323
SmPrx17-1_0 82 3.77e-18 1..38 1..38
PabPrx86 217 1.16e-69 96..283 134..326
SmPrx54-1_5 216 3.74e-69 98..283 140..329
SmPrx54-2_1 213 4.35e-68 98..283 140..329
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '7983' 'complement(join(374007..374402,374534..374990))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 374534..374990 455 N° 2 374007..374402 394  
complement(join(374007..374402,374534..374990))


exon

Literature and cross-references SmPrx[P]17b10_8
DNA ref. Phytozome 12:   scaffold_8 (374992..374008)
Protein sequence: SmPrx[P]17b10_8
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   282 (257)
PWM (Da):   %s   27449.1 (24731.7)  
PI (pH):   %s   10.19 (10.42) Peptide Signal:   %s   cut: 26 range:26-282
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MERIKGSTCLVLMLVAVIMVDLCQAQLSTTFYSKSCPRxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxELLQLVSINR*VYRHRLTDTFPCASKIGGRGWDVRLGRKDGRVSLASRV
PGNLPNVNMSVAQLTSFFKTRGFSQRELVVLSGGHSAGFAHCNKFMDRIYGRIDPTMDTGYARGLRGTCPQRNLDPTVVANLDTTTSTTFDNVFYQNLQSKKGLLRSDQVLYTDPNTKKV
VDSFASNNTAFLIEFAAVMDKLSAFKVKTGSQGEIRKNCGVIN

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incomplete sequencing, in frame stop codon, FHDC and SCADIL are missing.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGAGAATCAAAGGATCTACTTGCCTGGTCTTGATGCTTGTCGCCGTGATAATGGTTGATCTGTGCCAAGCCCAGCTCTCCACCACTTTCTACTCCAAATCCTGCCCGAGAGNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGAACTTCTCCAGCTCGTAAGCATCAA
TCGATAAGTATACCGGCATCGCCTCACTGACACTTTCCCCTGTGCTTCAAAGATTGGAGGACGCGGCTGGGATGTAAGGCTTGGAAGAAAAGACGGCAGAGTGTCACTAGCTTCGAGAGT
TCCCGGGAATTTGCCGAACGTAAACATGTCAGTTGCTCAGCTCACTTCATTCTTTAAAACTCGAGGATTCAGCCAAAGAGAATTGGTCGTCTTGTCC
GGTAAGTTTTTGAAAACCGCCCC
TGTGACCCTGTTAAATTCCCCTGTCCCGTGTTACGAATCTTCGATCATGCCTGTTCCTGATTTTCCTGTTCCTCCTTGTTTCCCTGACCAATTTTCCTCCACTGAGCAGGGGAGGCCACA
GTGCTGGTTTCGCTCACTGCAACAAGTTCATGGACCGGATTTATGGCAGAATTGATCCAACCATGGATACCGGTTACGCCAGGGGTCTCAGAGGTACATGTCCCCAAAGGAATCTGGACC
CGACTGTCGTTGCCAATCTCGACACCACCACTTCCACCACGTTTGACAATGTCTTCTACCAAAACCTCCAGAGCAAAAAGGGCCTTCTCCGCTCTGATCAAGTGCTATACACCGACCCGA
ACACTAAGAAAGTCGTGGACTCGTTTGCCTCCAACAACACTGCCTTTCTCATTGAGTTCGCGGCGGTCATGGACAAGTTGAGTGCCTTCAAGGTAAAGACAGGCTCTCAAGGTGAAATCC
GGAAAAACTGCGGGGTGATCAATTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGAGAATCAAAGGATCTACTTGCCTGGTCTTGATGCTTGTCGCCGTGATAATGGTTGATCTGTGCCAAGCCCAGCTCTCCACCACTTTCTACTCCAAATCCTGCCCGAGAGNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGAACTTCTCCAGCTCGTAAGCATCAA
TCGATAAGTATACCGGCATCGCCTCACTGACACTTTCCCCTGTGCTTCAAAGATTGGAGGACGCGGCTGGGATGTAAGGCTTGGAAGAAAAGACGGCAGAGTGTCACTAGCTTCGAGAGT
TCCCGGGAATTTGCCGAACGTAAACATGTCAGTTGCTCAGCTCACTTCATTCTTTAAAACTCGAGGATTCAGCCAAAGAGAATTGGTCGTCTTGTCC
GGAGGCCACAGTGCTGGTTTCGC
TCACTGCAACAAGTTCATGGACCGGATTTATGGCAGAATTGATCCAACCATGGATACCGGTTACGCCAGGGGTCTCAGAGGTACATGTCCCCAAAGGAATCTGGACCCGACTGTCGTTGC
CAATCTCGACACCACCACTTCCACCACGTTTGACAATGTCTTCTACCAAAACCTCCAGAGCAAAAAGGGCCTTCTCCGCTCTGATCAAGTGCTATACACCGACCCGAACACTAAGAAAGT
CGTGGACTCGTTTGCCTCCAACAACACTGCCTTTCTCATTGAGTTCGCGGCGGTCATGGACAAGTTGAGTGCCTTCAAGGTAAAGACAGGCTCTCAAGGTGAAATCCGGAAAAACTGCGG
GGTGATCAATTAG

Retrieve as FASTA