Entry information : SmPrx[P]104a_151
Entry ID 7984
Creation 2011-02-07 (Toky Ramarohetra)
Last sequence changes 2011-02-07 (Toky Ramarohetra)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2011-02-23 (Christophe Dunand)
Peroxidase information: SmPrx[P]104a_151
Name SmPrx[P]104a_151
Class Class III peroxidase     [Orthogroup: Prx038]*
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrx[P]104a_151
start..stop
S start..stop
SmPrx104-2_171 281 3e-95 12..244 15..333
SmPrx104-1_151 279 2e-94 34..244 32..333
SmPrx30-1_84 279 2e-94 34..244 29..329
SmPrx30-2_131 279 2e-94 34..244 29..329
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 233637..233866 230 N° 2 233907..233948 42 N° 3 234047..234076 30 N° 4 234149..234317 169
N° 5 234504..234764 261  
join(233637..233866,233907..233948,234047..234076,234149..234317,234504..234764)


exon

Literature and cross-references SmPrx[P]104a_151
DNA ref. Phytozome 12:   scaffold_151 (233738..234764)
Protein sequence: SmPrx[P]104a_151
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   244 (217)
PWM (Da):   %s   27066.26 (24149.8)  
PI (pH):   %s   5.1 (4.92) Peptide Signal:   %s   cut: 28 range:28-244
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASMLSSDRILMLCMVLPSFSFKGALSHSIGFGHSYAQTCPDAERIIRDTICDYANRDPTVPAGLIRLHFHDCFVNLCDASILLDSTPTDAIAARDSTVKMEGRHYEVVTGRYDGRVSSFDLASTTLPGPSFDAAALIENFNNxESLSIQDLVVLSGANTVEFDRGSQFNFDNWYFKNLEKRNDLLTSDQDLFESQFTSGLVKFYGNNPDKFARDFGQSMIKIRNIGWKTRENGEIKRVCNVVN

Retrieve as FASTA  
Remarks Pseudogene (bad introns, gaps, sequence shifts, in frame stop codons).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCCATGCTTTCGAGCGATCGAATCTTGATGCTTTGCATGGTTTTGCCTTCATTCAGCTTCAAGGGAGCTTTGTCACACTCGATTGGATTTGGACACAGCTACGCACAAACTTGT
CCCGATGCTGAGCGGATCATCCGCGACACGATCTGCGATTACGCCAATCGCGATCCAACAGTCCCGGCGGGACTGATACGCTTGCACTTTCACGACTGCTTCGTTAACGT
ACACTCCGGT
ATAGATAAGTTATACAATGTTCTTGGATTTGTGCGACGCCTCTATCCTTCTCGACTCAACTCCAACAGATATCCTCCAAACAACAATTCAGCGCAGGGATTCGAAGTTATTGACGATGCA
AAGAGAAGATTGGAGAAAGCCTGTCCTGGAGTGGTGTCGTGTGCAATTGCCATCGCCGCCAGGGATTCGACAGTCAAGCTTTGATCGTTTTTGTGTCAAGTGATTGAAAGCACTGAATTT
TTCCTCTCGAATGATCATATGATATTTTAGATGGAAGGCCGGCACTATGAAGTAGTCACTGGGCGCTACGATGGAAGAGTGTCAAGCTTCGATCTGGCAAGCACAACACTGCCAGGTCCC
TCGTTCGATGCTGCAGCTCTCATTGAAAACTTCAATAATTNNGAAAGCTTGTCCATTCAAGATCTCGTTGTTCTATCAGGT
TGGATAAATTAAACTATCTTAACAAATTCTTACACAAAT
TCTTGGCAGGAGCTCACACAGTTGGGGCCTCCAAGTGTTTTACTTTCGCCAACGGCCGATTTGATCGCATATACAGCTTCAAAAACACCAGCATGCAAGATGAAACTGTGAATCCCGAGT
ATTTGGCATATCTCCGGAGATTTCACCGCGAACACAGTCGAGTTTGACAGGGGCTCCCAGTTTAATTTCGACAACTGGTACTTCAAGAACTTGGAGAAGAGGAATGATCTTCTCACCTCT
GACCAGGACCTCTTTGAGAGTCAATTCACGAGTGGACTGGTGAAGTTTTACGGGAACAATCCCGATAAGTTTGCCCGGGACTTCGGGCAGTCCATGATCAAGATAAGAAACATTGGGTGG
AAGACGAGAGAAAATGGAGAGATCAAGAGGGTGTGTAATGTAGTAAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCCATGCTTTCGAGCGATCGAATCTTGATGCTTTGCATGGTTTTGCCTTCATTCAGCTTCAAGGGAGCTTTGTCACACTCGATTGGATTTGGACACAGCTACGCACAAACTTGT
CCCGATGCTGAGCGGATCATCCGCGACACGATCTGCGATTACGCCAATCGCGATCCAACAGTCCCGGCGGGACTGATACGCTTGCACTTTCACGACTGCTTCGTTAACGT
GTGCGACGCC
TCTATCCTTCTCGACTCAACTCCAACAGATAT
CATCGCCGCCAGGGATTCGACAGTCAAGCTGGAAGGCCGGCACTATGAAGTAGTCACTGGGCGCTACGATGGAAGAGTGTCAAGCTTC
GATCTGGCAAGCACAACACTGCCAGGTCCCTCGTTCGATGCTGCAGCTCTCATTGAAAACTTCAATAATTNNGAAAGCTTGTCCATTCAAGATCTCGTTGTTCTATCAGGT
GCGAACACA
GTCGAGTTTGACAGGGGCTCCCAGTTTAATTTCGACAACTGGTACTTCAAGAACTTGGAGAAGAGGAATGATCTTCTCACCTCTGACCAGGACCTCTTTGAGAGTCAATTCACGAGTGGA
CTGGTGAAGTTTTACGGGAACAATCCCGATAAGTTTGCCCGGGACTTCGGGCAGTCCATGATCAAGATAAGAAACATTGGGTGGAAGACGAGAGAAAATGGAGAGATCAAGAGGGTGTGT
AATGTAGTAAAC

Retrieve as FASTA