Entry information : BdiPrx51 (Bradi2g06497)
Entry ID 7985
Creation 2011-02-08 (Toky Ramarohetra)
Last sequence changes 2011-03-14 (Toky Ramarohetra)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-08 (Qiang Li)
Peroxidase information: BdiPrx51 (Bradi2g06497)
Name (synonym) BdiPrx51 (Bradi2g06497)
Class Class III peroxidase    [Orthogroup: Prx181]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Brachypodium
Organism Brachypodium distachyon    [TaxId: 15368 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BdiPrx51
start..stop
S start..stop
TaPrx72-1B 498 1e-179 27..327 24..325
TaPrx72-1D 497 5e-179 27..327 26..327
TaPrx72-1A 496 1e-178 27..327 26..327
OsPrx02 446 4e-159 23..327 14..317
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4964448..4964669 222 N° 2 4964788..4964979 192 N° 3 4965087..4965656 570  
join(4964448..4964669,4964788..4964979,4965087..4965656)


exon

Literature and cross-references BdiPrx51 (Bradi2g06497)
DNA ref. Phytozome 12:   Bd2 (4964448..4965656)
Protein sequence: BdiPrx51 (Bradi2g06497)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   327
PWM (Da):   %s   33601.95 Transmb domain:   %s   i13-32o
PI (pH):   %s   8.2
Sequence 368
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTSRASVTAGARVVAVVLAAAVVAVGGQLMPGFYDATCPGLPSLVRRGMAQAVQKEARMGASVLRLFFHDCFVNGCDASILLDDTANSPGEKNAGPNANSVRGYEVIDDIKAHVEASCKATVSCADILALAARDAVNLLGGPSWTVQLGRRDGRDANQYAANQNLPPPDATLPDLLARFRSKGLDARDLTALSGAHTVGWARCATFRAHVYNSSGAAIDAAFAAGLRARACPPAGGGGDGNLAPLEQRAPAAFDNGYFKDLVARRVLLRSDQELYGGGGGATDALVRAYAADGAAFAADFAAAMVKMGSLALTGNSGEVRLNCRRVN

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction from phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGACTAGCAGAGCGTCAGTGACGGCGGGAGCGCGCGTCGTCGCAGTTGTTCTGGCCGCGGCCGTCGTGGCGGTCGGCGGGCAGCTAATGCCGGGGTTCTACGACGCGACGTGCCCGGGGC
TGCCGTCCTTGGTGCGCCGCGGCATGGCGCAGGCGGTGCAGAAGGAGGCGCGCATGGGCGCCTCCGTCCTCCGCCTCTTCTTCCACGACTGCTTCGTCAAT
GTACGTCACTTGCTATACA
CATCCGATCAAGTCGCATCCAAATGCACGTTACGTACCGTCGTGTTTCAGGCCTGGGCATCGCGTACGGGCAGCGTTTCTGATAGAATTCATGGTGCAGGGGTGCGACGCGTCCATCTTG
CTGGACGACACGGCCAACTCCCCTGGCGAGAAGAACGCCGGGCCGAACGCCAACTCGGTGCGCGGCTACGAGGTCATCGACGACATCAAGGCGCACGTCGAGGCCTCCTGTAAAGCCACC
GTCTCCTGCGCCGACATCCTCGCCCTCGCTGCCCGCGACGCCGTCAACCTG
GTCCGCTCCTCTCTCATCTCTCTCCCAAGAAACACATGTCCGATCGAGTGAGTTTAGCTAGCTAGTGGC
ATTGTTAATTAATCGATCGCGTGGCTGGATGAATGCAGCTCGGGGGCCCGAGCTGGACGGTGCAGCTGGGCCGGCGGGACGGCCGCGACGCGAACCAATACGCGGCGAACCAGAACCTGC
CACCGCCAGACGCGACGCTCCCGGACCTCCTGGCCCGCTTCCGGTCCAAGGGCCTGGACGCCCGCGACCTCACCGCGCTCTCGGGGGCCCACACCGTCGGCTGGGCCCGCTGCGCCACCT
TCCGGGCCCACGTCTACAACAGCAGCGGCGCCGCCATCGACGCCGCATTCGCCGCGGGGCTGCGGGCCAGGGCGTGCCCGCCGGCGGGGGGCGGCGGCGACGGCAACCTGGCCCCGCTCG
AGCAGCGCGCGCCCGCGGCCTTCGACAACGGCTACTTCAAGGACCTCGTCGCCCGCCGCGTGCTGCTGCGGTCCGACCAGGAGCTCTACGGTGGCGGCGGCGGCGCAACGGACGCGCTCG
TGCGGGCCTATGCTGCCGATGGGGCCGCGTTTGCGGCAGACTTCGCCGCGGCTATGGTGAAGATGGGCAGCCTCGCGCTCACCGGGAACAGCGGCGAGGTCCGGCTCAACTGCCGCAGAG
TGAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGACTAGCAGAGCGTCAGTGACGGCGGGAGCGCGCGTCGTCGCAGTTGTTCTGGCCGCGGCCGTCGTGGCGGTCGGCGGGCAGCTAATGCCGGGGTTCTACGACGCGACGTGCCCGGGGC
TGCCGTCCTTGGTGCGCCGCGGCATGGCGCAGGCGGTGCAGAAGGAGGCGCGCATGGGCGCCTCCGTCCTCCGCCTCTTCTTCCACGACTGCTTCGTCAAT
GGGTGCGACGCGTCCATCT
TGCTGGACGACACGGCCAACTCCCCTGGCGAGAAGAACGCCGGGCCGAACGCCAACTCGGTGCGCGGCTACGAGGTCATCGACGACATCAAGGCGCACGTCGAGGCCTCCTGTAAAGCCA
CCGTCTCCTGCGCCGACATCCTCGCCCTCGCTGCCCGCGACGCCGTCAACCTG
CTCGGGGGCCCGAGCTGGACGGTGCAGCTGGGCCGGCGGGACGGCCGCGACGCGAACCAATACGCGG
CGAACCAGAACCTGCCACCGCCAGACGCGACGCTCCCGGACCTCCTGGCCCGCTTCCGGTCCAAGGGCCTGGACGCCCGCGACCTCACCGCGCTCTCGGGGGCCCACACCGTCGGCTGGG
CCCGCTGCGCCACCTTCCGGGCCCACGTCTACAACAGCAGCGGCGCCGCCATCGACGCCGCATTCGCCGCGGGGCTGCGGGCCAGGGCGTGCCCGCCGGCGGGGGGCGGCGGCGACGGCA
ACCTGGCCCCGCTCGAGCAGCGCGCGCCCGCGGCCTTCGACAACGGCTACTTCAAGGACCTCGTCGCCCGCCGCGTGCTGCTGCGGTCCGACCAGGAGCTCTACGGTGGCGGCGGCGGCG
CAACGGACGCGCTCGTGCGGGCCTATGCTGCCGATGGGGCCGCGTTTGCGGCAGACTTCGCCGCGGCTATGGTGAAGATGGGCAGCCTCGCGCTCACCGGGAACAGCGGCGAGGTCCGGC
TCAACTGCCGCAGAGTGAACTGA

Retrieve as FASTA