Entry information : BdiPrx34 (bradi1g57247)
Entry ID 7988
Creation 2011-02-08 (Toky Ramarohetra)
Last sequence changes 2011-02-08 (Toky Ramarohetra)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-08 (Qiang Li)
Peroxidase information: BdiPrx34 (bradi1g57247)
Name (synonym) BdiPrx34 (bradi1g57247)
Class Class III peroxidase    [Orthogroup: Prx127]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Brachypodium
Organism Brachypodium distachyon    [TaxId: 15368 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BdiPrx34
start..stop
S start..stop
TaPrx33 485 9e-175 25..319 26..320
SiPrx157 463 7e-166 24..319 32..330
SbPrx14 463 1e-165 27..319 49..344
OsPrx4849 458 1e-163 11..319 25..335
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 55976368..55976574 207 N° 2 55976668..55976862 195 N° 3 55977199..55977364 166 N° 4 55978347..55978738 392
join(55976368..55976574,55976668..55976862,55977199..55977364,55978347..55978738 )


exon

Literature and cross-references BdiPrx34 (bradi1g57247)
DNA ref. Phytozome 12:   Bd1 (55976368..55978738)
Protein sequence: BdiPrx34 (bradi1g57247)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   319 (295)
PWM (Da):   %s   33184.23 (30789.0)  
PI (pH):   %s   4.56 (4.36) Peptide Signal:   %s   cut: 25 range:25-319
Sequence 360
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASKHGWIACVLFLVAAAAAKANAQLSEDYYDASCPAALLTIRAAVATAVLLNRRMGASLLRLHFHDCFGCDASVLLDDTDDGFTGEKGAGPNAGSLLGFEVIDRIKMLLELMCPRTVSCADILAVAARDSVVSLGGPSWTVLLGRRDATTASASLANSDLPGPTSNLNNLLSAFSKKGLSSTDMVALSGAHTIGRAQCKNYQDRIYNDTDIDGPFAASLRADCPQAAGGNDGSLAPLDVSSPDAFDNSYFSGLLYRQGLLHSDQALYDGGSTDELVKSYASDGDRFGCDFAAAMVNMGNISPLTGADGEIRVNCRAVN

Retrieve as FASTA  
Remarks Complete sequence from gwnomic (chromo, 3 introns). Incomplete prediction from ensembl (FHDC is missing). No prediction from phytozome
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCTTCAAAGCACGGTTGGATCGCTTGTGTACTGTTTCTCGTCGCAGCTGCGGCAGCCAAAGCCAATGCACAGCTCTCAGAGGACTACTACGACGCTTCCTGCCCCGCGGCGCTACTCA
CCATCAGGGCTGCCGTGGCAACGGCGGTGCTGCTCAACCGCCGCATGGGCGCCTCCCTCCTCCGGCTTCACTTCCACGACTGCTTC
GTGCAAGCAAGTCTCCTTAATTTTTCTCTCTTCC
TCTGTTAATTTACACTGATCGGGTCTTCGATCAGTAATATGGACATCTAATGGTGGCAGGGCTGCGATGCTTCCGTGCTCCTCGACGACACAGACGACGGATTCACCGGCGAGAAAGGGG
CTGGGCCGAACGCCGGGTCGCTGCTGGGTTTCGAGGTGATCGACAGGATCAAGATGCTGCTGGAGCTCATGTGTCCGCGTACCGTCTCCTGTGCCGACATCCTCGCCGTCGCCGCCCGGG
ACTCCGTCGTCAGT
GTAAGCTAGTTAAGCTCGCGCTAGAGCACTGAATTCAAGCTCGCTAGAGCACCGAATGTGTCCACGGACTATAGGTCACGGTATATGACCGGACGCATTTCAAAGT
GCGTCAAATTTATATTCGTGGCATTTTAAAAGTGTGAATATACTCGTGTTGGCAAAAGTATTTGACGTTTTTTTTTTGACAGAATCTGCGGTTGAAGTGCTAAAACTGCGGTTAAAATCA
AAATTAACTACGTTTGAACAAAGTGCAGCTAACATAGTGCCGATCGATCATTTCGTCGGCGGAATTTAATTTAATTAGTACTATACCATTTTTGTTGGACTTTTTTTCAGCTAGGGGGCC
CTTCATGGACGGTTCTACTTGGGAGGAGGGATGCCACCACAGCAAGTGCGTCCTTGGCCAACAGTGACCTCCCCGGCCCGACCTCCAACCTCAACAATCTCCTCAGCGCCTTCTCCAAAA
AGGGACTCAGCAGCACCGATATGGTTGCTCTCTCAG
GTAGAGTATTTTTTTCGAGGAGGAGGAAACCCGTTGGACTCTGCATCAACAGTCATGTATCACGGCCAACAAACTTTAAACTAT
CGCCACCAAAGAAATTAACTTCAAAGTATCTAACGAACGAGCAACTTTGTAGAGGTAAACGATGATCAATCTAGTGCAGGCAGTACATCTATGTCGTCCTCTAGTGCGTATATATGCATA
TTATTGCATGCAGGCACCATCCAAAGTGCCTATGCGCGTATATGTGTGTAGGCTTTTTAGTGCCATTACGACTCTTTTTTCACAAGTTCTTGGCAACTTCTTTCCGTTCACCTAATGATC
GTCATCGTCCCAGTGATTCATCCAGGGTGCATGTGCATCCAGTATAGCTCTTGTCTCTATTCTCGGCTCACAGTACCTTTCCTTTTCGCAACCAGACAAGGCACATGCATGCATTCACGA
GACATCAAGTACCTGATCACTCGAGTGGTCAAAATGTGCCACCCAACCACCCCCTATATATTCAGTGACCCCATATGCATGCAACATGCAATGTTTCTGAGACAAAACAAAAGAAGAAAT
ATGCCGTGCAAATCGTTCATGCATGCTTGCATGTTACTCTATCGACCAATCAAAAGACCCCAAGAAAGCAAAATGCGAGAGCGACGTTTCGATCAATATAGTAGATCAAAAGCTCCCAAA
AAACAATAGGTTGCACCAAATGATTATATTTTGAAAAACTTGAGCCCATGATTTTGTTTAAAAATGTAATATAAAGAAATCCTTAAATTCTACAGAACTTTTGTGATATATAGACCATAT
AACTAGATAAGTAAATCTGCCAATGTAACGTATTGTTTTTCTAGTGTAGGTTAGTAGACTATTCCAAAATGCGAAACCTCATATATTTCGATCAATATAATAGATCAAAAGCTCCCAAGG
AAAATCACCGCATTATTCTTGCTGCCTCGCCGGCCATGTGAAATGTACATCTCTGCAGGAGCCCACACCATAGGCCGCGCGCAGTGCAAGAACTACCAGGACAGGATCTACAACGACACC
GACATCGACGGCCCGTTTGCGGCGTCGCTGCGTGCCGACTGCCCCCAGGCCGCAGGCGGCAACGATGGCAGCCTCGCGCCGCTTGATGTGTCCTCGCCTGACGCCTTCGACAACAGCTAC
TTCTCCGGCCTCCTCTACCGCCAGGGGCTGTTGCACTCCGACCAGGCGTTGTACGACGGCGGCTCCACTGACGAACTGGTCAAGAGCTACGCGTCCGATGGTGATCGGTTTGGCTGCGAC
TTCGCGGCGGCAATGGTGAACATGGGCAATATCAGCCCGCTCACAGGGGCGGATGGCGAGATCAGGGTGAACTGCAGGGCGGTGAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCTTCAAAGCACGGTTGGATCGCTTGTGTACTGTTTCTCGTCGCAGCTGCGGCAGCCAAAGCCAATGCACAGCTCTCAGAGGACTACTACGACGCTTCCTGCCCCGCGGCGCTACTCA
CCATCAGGGCTGCCGTGGCAACGGCGGTGCTGCTCAACCGCCGCATGGGCGCCTCCCTCCTCCGGCTTCACTTCCACGACTGCTTC
GGCTGCGATGCTTCCGTGCTCCTCGACGACACAG
ACGACGGATTCACCGGCGAGAAAGGGGCTGGGCCGAACGCCGGGTCGCTGCTGGGTTTCGAGGTGATCGACAGGATCAAGATGCTGCTGGAGCTCATGTGTCCGCGTACCGTCTCCTGTG
CCGACATCCTCGCCGTCGCCGCCCGGGACTCCGTCGTCAGT
CTAGGGGGCCCTTCATGGACGGTTCTACTTGGGAGGAGGGATGCCACCACAGCAAGTGCGTCCTTGGCCAACAGTGACC
TCCCCGGCCCGACCTCCAACCTCAACAATCTCCTCAGCGCCTTCTCCAAAAAGGGACTCAGCAGCACCGATATGGTTGCTCTCTCAG
GAGCCCACACCATAGGCCGCGCGCAGTGCAAGA
ACTACCAGGACAGGATCTACAACGACACCGACATCGACGGCCCGTTTGCGGCGTCGCTGCGTGCCGACTGCCCCCAGGCCGCAGGCGGCAACGATGGCAGCCTCGCGCCGCTTGATGTGT
CCTCGCCTGACGCCTTCGACAACAGCTACTTCTCCGGCCTCCTCTACCGCCAGGGGCTGTTGCACTCCGACCAGGCGTTGTACGACGGCGGCTCCACTGACGAACTGGTCAAGAGCTACG
CGTCCGATGGTGATCGGTTTGGCTGCGACTTCGCGGCGGCAATGGTGAACATGGGCAATATCAGCCCGCTCACAGGGGCGGATGGCGAGATCAGGGTGAACTGCAGGGCGGTGAATTAA

Retrieve as FASTA