Entry information : ZmAPx[P]01 (GRMZM2G150356 [6a])
Entry ID 8000
Creation 2011-02-18 (Christophe Dunand)
Last sequence changes 2011-02-18 (Christophe Dunand)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2015-07-07 (Christophe Dunand)
Peroxidase information: ZmAPx[P]01 (GRMZM2G150356 [6a])
Name (synonym) ZmAPx[P]01 (GRMZM2G150356 [6a])
Class Ascorbate peroxidase     [Orthogroup: APx001]*
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmAPx[P]01
start..stop
S start..stop
ZmAPx[P]02 259 1e-91 1..127 1..127
ZmAPx[P]06 258 4e-91 1..127 1..127
ZmAPx[P]05 258 4e-91 1..127 1..127
ZmAPx[P]04 258 4e-91 1..127 1..127
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 190998892..190998943 52 N° 2 190999186..190999271 86 N° 3 190999355..190999434 80 N° 4 190999590..190999692 103
N° 5 190999769..190999828 60  
join(190998892..190998943,190999186..190999271,190999355..190999434,190999590..1 90999692,190999769..190999828)


exon

Literature and cross-references ZmAPx[P]01 (GRMZM2G150356 [6a])
Protein sequence: ZmAPx[P]01 (GRMZM2G150356 [6a])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   127
PWM (Da):   %s   14020.09  
PI (pH):   %s   5.22
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
QDKPQPPPEGRLPDATKGSDHLRQVFGKQMGLSDQDIVALSGGHTGRCHKERSGFEGAWTTNPLVFDNSYFKELLSGDKEGLLQLPSDKALLSDPVFRPLVEKYADEKAFFDDYKEAHLKLSELG

Retrieve as FASTA  
Remarks Pseudogene (chromo 2). Large 5' part and last exon are missing.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CAGGACAAGCCTCAGCCGCCACCTGAGGGCCGTCTTCCTGATGCCACCAAGGGTAGATTTCTAATCTTTACTAGATTGGCATGAATGCTGAGTTAATGGGTTACATTCACCTTGCATCCT
TTGTTAAGTGTTTCAAAGGTGTTGTTTTGGCATCCCTGTACCCAGCTTGCTTTGGGTAACAGTGGTGCCTTGTAGCCGAGGCACCGTGTAGGCGTCCAGACCAAACACTGGTTTTGATGT
CACTTCTATTGACACGAGGACTGGCACTTGCTGCTTGCTTTTTTTTGAAACCAGGTTCTGACCACCTGAGGCAAGTCTTTGGCAAGCAGATGGGTTTGAGTGATCAGGACATCGTTGCCC
TCTCTGGTGGCCACACCTTG
GTTTGTTGTTGTCCACTCATGTTTGATTCAGGAATGTAATGTTTATGCCTGTACTGATTTAGTTTTCTTTGAGGTTTTATTAGGGAAGGTGCCACAAAGA
GCGGTCTGGTTTTGAGGGGGCCTGGACTACGAACCCTTTGGTCTTTGACAACTCTTACTTCAA
GTGAGTCTGTCTTGTTTACTATTGAAAAGCAACTGCATTTAGTTAAGAAATACTTAA
AATTTGTTTACCTTTGTTATGTCATTACTGGGCAGCTGAATGCTGTGCTAGAAATTAATAGTCGTCCCATATCTCCTACTATTCCCATATTTTCATAGGGAACTTCTGAGTGGTGACAAG
GAGGGCCTTCTTCAGCTCCCAAGTGACAAAGCCCTGCTGAGCGACCCTGTCTTCCGCCCTCTTGTGGAGAAATATGCTGCA
GTATGTCCTTGGTCATTGTTATCCAGGGTATGGAGATTC
GTAGGGAGGCAAGTACTGATTATCGTGTGCTTTGTAGGATGAGAAGGCATTCTTTGATGACTACAAAGAGGCCCACCTCAAGCTCTCCGAACTGGGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CAGGACAAGCCTCAGCCGCCACCTGAGGGCCGTCTTCCTGATGCCACCAAGGGTTCTGACCACCTGAGGCAAGTCTTTGGCAAGCAGATGGGTTTGAGTGATCAGGACATCGTTGCCCTC
TCTGGTGGCCACACCTTG
GGAAGGTGCCACAAAGAGCGGTCTGGTTTTGAGGGGGCCTGGACTACGAACCCTTTGGTCTTTGACAACTCTTACTTCAAGGAACTTCTGAGTGGTGACAAG
GAGGGCCTTCTTCAGCTCCCAAGTGACAAAGCCCTGCTGAGCGACCCTGTCTTCCGCCCTCTTGTGGAGAAATATGCTGCA
GATGAGAAGGCATTCTTTGATGACTACAAAGAGGCCCAC
CTCAAGCTCTCCGAACTGGGA

Retrieve as FASTA