Entry information : ZmAPx[P]04
Entry ID 8003
Creation 2011-02-18 (Christophe Dunand)
Last sequence changes 2011-02-18 (Christophe Dunand)
Sequence status theoretical translation / pseudogene
Reviewer Qiang Li
Last annotation changes 2012-08-13 (Qiang Li)
Peroxidase information: ZmAPx[P]04
Name ZmAPx[P]04
Class Ascorbate peroxidase     [Orthogroup: APx001]*
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmAPx[P]04
start..stop
S start..stop
ZmAPx[P]06 260 6e-92 1..127 1..127
ZmAPx[P]05 260 6e-92 1..127 1..127
ZmAPx[P]03 260 6e-92 1..127 1..127
ZmAPx[P]07 258 3e-91 2..127 1..126
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 170904334..170904385 52 N° 2 170904629..170904714 86 N° 3 170904798..170904877 80 N° 4 170905033..170905135 103
N° 5 170905212..170905271 60  
join(170904334..170904385,170904629..170904714,170904798..170904877,170905033..1 70905135,170905212..170905271)


exon

Literature and cross-references ZmAPx[P]04
Protein ref. Phytozome 12:   chromo 7 (170904334..170905271)
Protein sequence: ZmAPx[P]04
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   127
PWM (Da):   %s   14019.1  
PI (pH):   %s   5.63
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
QDKPQPPPEGRLPDATKGSNHLRQVFGKQMGLSDQDIVALSGGHTGRCHKERSGFEGAWTTNPLVFDNSYFKELLSGDKEGLLQLPSDKALLSDPVFRPLVEKYADEKAFFDDYKEAHLKLSELG

Retrieve as FASTA  
Remarks Pseudogene (chromo 7). Large 5' and last exon are missing.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CAGGACAAGCCTCAGCCGCCACCTGAGGGCCGTCTTCCTGATGCCACCAAGGGTAGATTTCTAATCTTTACTAGATTGGCATGAATGCTGAGTTAATGAGTTACATTCACCTTGCATCCT
TTGTTAAGTGTTTCAAAGGTGTTGTTTTGGCATCCCTGTACCCAGCTTGCTTTGGGTAACAGTGGTGCCTTTTAGCCGAGGCACTGTGTAGGCGTCTAGACCAAACACTGGTTTTGATGT
CACTTCTATTGACACGAGGACTGGCACTTGCTGCTTGCTTTTTTTTTGAAACCAGGTTCTAACCACCTGAGGCAAGTCTTTGGCAAGCAGATGGGTTTGAGTGATCAGGACATCGTTGCC
CTCTCTGGTGGCCACACCTTG
GTTTCTTGCTGTCCACTCATGTTTGATTCAGGAATGTAATGTGTATGCCTGTACTGATTTAGTTTTCTTTGAGGTTTTATTAGGGAAGGTGCCACAAAG
AGCGGTCTGGTTTTGAGGGGGCCTGGACTACGAACCCTTTGGTCTTTGACAACTCTTACTTCAA
GTGAGTCTGTCTTGTTTACTATTGAAAAGCAACTGCATTTAGTTAAGAAATACTTA
AAATTTGTTTACCTTTGTTATGTCATTACTTGGCAGCTGAATGCTGTGCTAGAAATTAATAGCCGTCCCATATCTCCTACTATTCCCATATTTTCATAGGGAACTTCTGAGTGGTGACAA
GGAGGGCCTTCTTCAGCTCCCAAGTGACAAAGCCCTGCTGAGCGACCCTGTCTTCCGCCCTCTTGTGGAGAAATATGCTGCA
GTATGTCCTTGGTCATTGTTATCCAGGGTATGGAGATT
CGTAGGGAGGCAAGTACTGATTATCGTGTGCTCTGTAGGATGAGAAGGCATTCTTTGATGACTACAAAGAGGCCCACCTCAAGCTCTCCGAACTGGGG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CAGGACAAGCCTCAGCCGCCACCTGAGGGCCGTCTTCCTGATGCCACCAAGGGTTCTAACCACCTGAGGCAAGTCTTTGGCAAGCAGATGGGTTTGAGTGATCAGGACATCGTTGCCCTC
TCTGGTGGCCACACCTTG
GGAAGGTGCCACAAAGAGCGGTCTGGTTTTGAGGGGGCCTGGACTACGAACCCTTTGGTCTTTGACAACTCTTACTTCAAGGAACTTCTGAGTGGTGACAAG
GAGGGCCTTCTTCAGCTCCCAAGTGACAAAGCCCTGCTGAGCGACCCTGTCTTCCGCCCTCTTGTGGAGAAATATGCTGCA
GATGAGAAGGCATTCTTTGATGACTACAAAGAGGCCCAC
CTCAAGCTCTCCGAACTGGGG

Retrieve as FASTA