Entry information : ZmAPx[P]06
Entry ID 8005
Creation 2011-02-18 (Christophe Dunand)
Last sequence changes 2011-02-18 (Christophe Dunand)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2011-02-18 (Christophe Dunand)
Peroxidase information: ZmAPx[P]06
Name ZmAPx[P]06
Class Ascorbate peroxidase     [Orthogroup: APx001]*
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmAPx[P]06
start..stop
S start..stop
ZmAPx[P]05 260 6e-92 1..127 1..127
ZmAPx[P]04 260 6e-92 1..127 1..127
ZmAPx[P]03 260 6e-92 1..127 1..127
ZmAPx[P]07 258 3e-91 2..127 1..126
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 150999880..150999928 49 N° 2 150999551..150999636 86 N° 3 150999388..150999467 80 N° 4 150999130..150999232 103
N° 5 150998991..150999053 63  
complement(join(150998991..150999053,150999130..150999232,150999388..150999467,1 50999551..150999636,150999880..150999928))


exon

Literature and cross-references ZmAPx[P]06
Protein sequence: ZmAPx[P]06
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   127
PWM (Da):   %s   14019.1  
PI (pH):   %s   5.63
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
QDKPQPPPEGRLPDATKGSNHLRQVFGKQMGLSDQDIVALSGGHTLGRCHKERSGFEGAWTTNPLVFDNSYFKELLSGDKEGLLQLPSDKALLSDPVFRPLVEKYAADEKAFFDDYKEAHLKLSELG

Retrieve as FASTA  
Remarks Pseudogene (chromo 1). Large 5' part and last exon are missing.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CAGGACAAGCCTCAGCCGCCACCTGAGGGCCGTCTTCCTGATGCCACCAAGGGTAGATTTCTAATCTTTACTAGATTGGCATGAATGCTGAGTTAATGAGTTACATTCACCTTGCATCCT
TTGTTAAGTGTTTCAAAGGTGTTGTTTTGGCATCCCTGTACCCAGCTTGCTTTGGGTAACAGTGGTGCCTTGTAGCCGAGGCACCGTGTAGGCGTCCAGACCAAACACTGGTTTTGATGT
CACTTCTATTGACACGAGGACTGGCGCTTGCTGCTTGCTTTTTTTTTGAAACCAGGTTCTAACCACCTGAGGCAAGTCTTTGGCAAGCAGATGGGTTTGAGTGATCAGGACATCGTTGCC
CTCTCTGGTGGCCACACC
TTGGTTTGTTGCTGTCCACTCATGTTTGATTCAGGAATGTAATGTGTATGCCTGTACTGATTTAGTTTTCTTTGAGGTTTTATTAGGGAAGGTGCCACAAAG
AGCGGTCTGGTTTTGAGGGGGCCTGGACTACGAACCCTTTGGTCTTTGACAACTCTTACTT
CAAGTGAGTCTGTCTTGTTTACTATTGAAAAGCAACTGCATTTAGTTAAGAAATACTTA
AAATTTGTTTACCTTTGTTATGTCATTACTTGGCAGCTGAATGCTGTGCTAGAAATTAATAGCCGTCCCATATCTCCTACTATTCCCATATTTTCATAGGGAACTTCTGAGTGGTGACAA
GGAGGGCCTTCTTCAGCTCCCAAGTGACAAAGCCCTGCTGAGCGACCCTGTCTTCCGCCCTCTTGTGGAGAAATATGCT
GCAGTATGTCCTTGGTCATTGTTATCCAGGGTATGGAGATT
CGTAGGGAGGCAAGTACTGATTATCGTGTGCTCTGTAGGATGAGAAGGCATTCTTTGATGACTACAAAGAGGCCCACCTCAAGCTCTCCGAACTGGGG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CAGGACAAGCCTCAGCCGCCACCTGAGGGCCGTCTTCCTGATGCCACCACAGGTTCTAACCACCTGAGGCAAGTCTTTGGCAAGCAGATGGGTTTGAGTGATCAGGACATCGTTGCCCTC
TCTGGTGGCCACACC
TAGGGAAGGTGCCACAAAGAGCGGTCTGGTTTTGAGGGGGCCTGGACTACGAACCCTTTGGTCTTTGACAACTCTTACTTTAGGGAACTTCTGAGTGGTGACAAG
GAGGGCCTTCTTCAGCTCCCAAGTGACAAAGCCCTGCTGAGCGACCCTGTCTTCCGCCCTCTTGTGGAGAAATATGCT
TAGGATGAGAAGGCATTCTTTGATGACTACAAAGAGGCCCAC
CTCAAGCTCTCCGAACTGGGG

Retrieve as FASTA