Entry information : ZmAPx[P]07
Entry ID 8006
Creation 2011-02-18 (Christophe Dunand)
Last sequence changes 2011-02-18 (Christophe Dunand)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2011-02-18 (Christophe Dunand)
Peroxidase information: ZmAPx[P]07
Name ZmAPx[P]07
Class Ascorbate peroxidase     [Orthogroup: APx001]*
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmAPx[P]07
start..stop
S start..stop
ZmAPx[P]02 264 2e-93 1..130 2..131
ZmAPx05 266 1e-92 1..130 121..250
ZmAPx01 265 6e-92 1..130 121..250
ZmAPx[P]06 258 3e-91 1..126 2..127
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 240905283..240905331 49 N° 2 240904954..240905039 86 N° 3 240904791..240904870 80 N° 4 240904533..240904635 103
N° 5 240904398..240904456 59 N° 6 240904307..240904322 16  
complement(join(240904307..240904322,240904398..240904456,240904533..240904635,2 40904791..240904870,240904954..240905039,240905283..240905331))


exon

Literature and cross-references ZmAPx[P]07
Protein sequence: ZmAPx[P]07
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   130
PWM (Da):   %s   14297.19  
PI (pH):   %s   5.63
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
DKPQPPPEGRLPDATKGSNHLRQVFGKQMGLSDQDIVALSGGHTGRCHKERSGFEGAWTTNPLVFDNSYFKELLSGDKEGLLQLPSDKALLSDPVFRPLVEKYADEKAFFDDYKEAHLKLSELGYADA

Retrieve as FASTA  
Remarks Pseudogene (chromo 4). Large 5' end is missing.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GACAAGCCTCAGCCGCCACCTGAGGGCCGTCTTCCTGATGCCACCAAGGGTAGATTTCTAATCTTTACTAGATTGGCATGAATGCTGAGTTAATGAGTTACATTCACCTTGCATCCTTTG
TTAAGTGTTTCAAAGGTGTTGTTTTGGCATCCCTGTACCCAGCTTGCTTTGGGTAACAGTGGTGCCTTGTAGCCGAGGCACCGTGTAGGCGTCCAGACCAAACACTGGTTTTGATGTCAC
TTCTATTGACACGAGGACTGGCACTTGCTGCTTGCTTTTTTTTTGAAACCAGGTTCTAACCACCTGAGGCAAGTCTTTGGCAAGCAGATGGGTTTGAGTGATCAGGACATCGTTGCCCTC
TCTGGTGGCCACACCTTG
GTTTGTTGCTGTCCACTCATGTTTGATTCAGGAATGTAATGTGTATGCCTGTACTGATTTAGTTTTCTTTGAGGTTTTATTAGGGAAGGTGCCACAAAGAGC
GGTCTGGTTTTGAGGGGGCCTGGACTACGAACCCTTTGGTCTTTGACAACTCTTACTTCAA
GTGAGTCTGTCTTGTTTACTATTGAAAAGCAACTGCATTTAGTTAAGAAATACTTAAAA
TTTGTTTACCTTTGTTATGTCATTACTTGGCAGCTGAATGCTGTGCTAGAAATTAATAGCCGTCCCATATCTCCTACTATTCCCATATTTTCATAGGGAACTTCTGAGTGGTGACAAGGA
GGGCCTTCTTCAGCTCCCAAGTGACAAAGCCCTGCTGAGCGACCCTGTCTTCCGCCCTCTTGTGGAGAAATATGCTGCA
GTATGTCCTTGGTCATTGTTATCCAGGGTATGGAGATTCGT
AGGGAGGCAAGTACTGATTATCGTGTGCTCTGTAGGATGAGAAGGCATTCTTTGATGACTACAAAGAGGCCCACCTCAAGCTCTCCGAACTGGGGTGAGTAACCATTGGTTGCACAATTT
GTGCTTGGTTAGTGGAACAAATCTGATCGTTTACTCTTCTGGGGTGCAGGTATGCTGATGCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GACAAGCCTCAGCCGCCACCTGAGGGCCGTCTTCCTGATGCCACCAAGGGTTCTAACCACCTGAGGCAAGTCTTTGGCAAGCAGATGGGTTTGAGTGATCAGGACATCGTTGCCCTCTCT
GGTGGCCACACCTTG
GGAAGGTGCCACAAAGAGCGGTCTGGTTTTGAGGGGGCCTGGACTACGAACCCTTTGGTCTTTGACAACTCTTACTTCAAGGAACTTCTGAGTGGTGACAAGGAG
GGCCTTCTTCAGCTCCCAAGTGACAAAGCCCTGCTGAGCGACCCTGTCTTCCGCCCTCTTGTGGAGAAATATGCTGCA
GATGAGAAGGCATTCTTTGATGACTACAAAGAGGCCCACCTC
AAGCTCTCCGAACTGGG
GTATGCTGATGCTTAA

Retrieve as FASTA