Entry information : ZmAPx[P]08
Entry ID 8007
Creation 2011-02-18 (Christophe Dunand)
Last sequence changes 2011-02-18 (Christophe Dunand)
Sequence status theoretical translation / pseudogene
Reviewer Qiang Li
Last annotation changes 2012-08-13 (Qiang Li)
Peroxidase information: ZmAPx[P]08
Name ZmAPx[P]08
Class Ascorbate peroxidase     [Orthogroup: APx001]*
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmAPx[P]08
start..stop
S start..stop
ZmAPx[P]06 255 7e-90 1..127 1..127
ZmAPx[P]05 255 7e-90 1..127 1..127
ZmAPx[P]04 255 7e-90 1..127 1..127
ZmAPx[P]03 255 7e-90 1..127 1..127
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 166071342..166071393 52 N° 2 166071633..166071718 86 N° 3 166071802..166071881 80 N° 4 166072037..166072139 103
N° 5 166072216..166072275 60  
join(166071342..166071393,166071633..166071718,166071802..166071881,166072037..1 66072139,166072216..166072275)


exon

Literature and cross-references ZmAPx[P]08
Protein sequence: ZmAPx[P]08
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   126
PWM (Da):   %s   13918.05  
PI (pH):   %s   5.63
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
QDKPQPPPEGRLPDATKGSNHLRQVFGKQMGLSD*DIVALSGGHTGRCHKERSGFEGAWTTNPLVFDNSYFKELLSGDKEGLLQLPSDKALLNDPVFRPLVEKYADEKAFFDDYKEAHLKLSELG

Retrieve as FASTA  
Remarks Pseudogene (chromo 4) from genomic. Large 5' part and last exon are missing.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CAGGACAAGCCTCAGCCGCCACCTGAGGGCCGTCTTCCTGATGCCACCAAGGGTAGATTTCTAATCTTTACTAGATTGGCATGAATGCTGAGTTAATGAGTTACATTCACCTTGCATCCT
TTGTTAAGTGTTTCAAAGGTGTTGTTTTGGCATCCCTGTACCCAGCTTGCTTTGGGTAACAGTGGTGCCTTGTAGCCGAGGCACCGTGTAGGCGTCCAGACCAAACACTGGTTTTGATGT
CACTTCTATTGACACGAGGACTGGCACTTGCTGCTTTTTTTTTGAAACCAGGTTCTAACCACCTGAGGCAAGTCTTTGGCAAGCAGATGGGTTTGAGTGATTAGGACATCGTTGCCCTCT
CTGGTGGCCACACCTTG
GTTTGTTGCTGTCCACTCATGTTTGATTCAGGAATGTAATGTGTATGCCTGTACTGATTTAGTTTTCTTTGAGGTTTTATTAGGGAAGGTGCCACAAAGAGCG
GTCTGGTTTTGAGGGGGCCTGGACTACAAACCCTTTGGTCTTTGACAACTCTTACTTCAA
GTGAGTCTGTCTTGTTTACTATTGAAAAGCAACTGCATTTAGTTAAGAAATACTTAAAAT
TTGTTTACCTTTGTTATGTCATTACTTGGCAGCTGAATGCTGTGCTAGAAATTAATAGCCGTCCCATATCTCCTACTATTCCCATATTTTCATAGGGAACTTCTGAGTGGTGACAAGGAG
GGCCTTCTTCAGCTCCCAAGTGACAAAGCCCTGCTGAACGACCCTGTCTTCCGCCCTCTTGTGGAGAAATATGCTGCA
GTATGTCCTTGGTCATTGTTATCCAGGGTATGGAGATTCGTA
GGGAGGCAAGTACTGATTATCGTGTGCTCTATAGGATGAGAAGGCATTCTTTGATGACTACAAAGAGGCCCACCTCAAGCTCTCTGAACTGGGG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CAGGACAAGCCTCAGCCGCCACCTGAGGGCCGTCTTCCTGATGCCACCAAGGGTTCTAACCACCTGAGGCAAGTCTTTGGCAAGCAGATGGGTTTGAGTGATTAGGACATCGTTGCCCTC
TCTGGTGGCCACACCTTG
GGAAGGTGCCACAAAGAGCGGTCTGGTTTTGAGGGGGCCTGGACTACAAACCCTTTGGTCTTTGACAACTCTTACTTCAAGGAACTTCTGAGTGGTGACAAG
GAGGGCCTTCTTCAGCTCCCAAGTGACAAAGCCCTGCTGAACGACCCTGTCTTCCGCCCTCTTGTGGAGAAATATGCTGCA
GATGAGAAGGCATTCTTTGATGACTACAAAGAGGCCCAC
CTCAAGCTCTCTGAACTGGGG

Retrieve as FASTA