Entry information : ZmAPx[P]09
Entry ID 8008
Creation 2011-02-18 (Christophe Dunand)
Last sequence changes 2011-02-18 (Christophe Dunand)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2011-02-18 (Christophe Dunand)
Peroxidase information: ZmAPx[P]09
Name ZmAPx[P]09
Class Ascorbate peroxidase     [Orthogroup: APx001]*
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmAPx[P]09
start..stop
S start..stop
ZmAPx02_B73 268 5e-93 1..137 1..137
SbAPx02 266 2e-92 1..137 1..137
ZmAPx02_H99 263 5e-91 1..137 1..137
SiAPx02 255 6e-88 1..137 1..137
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 228027562..228027680 119 N° 2 228027778..228027952 175 N° 3 228028041..228028106 66 N° 4 228028701..228028751 51
join(228027562..228027680,228027778..228027952,228028041..228028106,228028701..2 28028751)


exon

Literature and cross-references ZmAPx[P]09
Protein sequence: ZmAPx[P]09
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   136
PWM (Da):   %s   14481.55  
PI (pH):   %s   8.22
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVKAYPTVNEDYLKAVDKAKRKLRGLIAEKNCAPLMLCLAWHSAGTSDVATKTGGPFGTMKNPAEQAHGANVGLEIAVRLL*PIKEQFPILSYIDFYLAGVVAVEVTGGPDVPFHPGRQDKPEPPPEGRLPGATQG

Retrieve as FASTA  
Remarks Pseudogene (chromo 2). Stop codon in frame and large 3' part is missing.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGAAGGCTTACCCCACGGTGAACGAGGACTACCTCAAGGCGGTCGACAAGGCCAAGCGCAAGCTCCGCGGCCTCATCGCCGAGAAGAATTGCGCCCCGCTCATGCTCTGCCTCGCG
TAAGGCTGCTCCCCCTTCTTATTCTTCGCCCGATCCCGATCCTATTCGGAAATCCCGAAACTACTACCACTCCAACTCCTTCCTTTCCCCTCGCCGATGGCACTCCGCGGGCACCTCCGA
TGTGGCCACCAAAACCGGGGGGCCCTTCGGCACCATGAAGAACCCCGCCGAGCAGGCACACGGAGCCAACGTCGGGCTAGAAATTGCAGTCAGGCTGCTATAGCCCATCAAGGAGCAGTT
CCCCATCCTATCCTACATTGACTTCTACCAG
GTTACCTACCTATTGCAACTTCGATTACCCATCCTTTCGTATGATTAGATAGACTAACACAAATTTATTTATGGTTGCGGTGTTGCAGC
TTGCTGGAGTCGTGGCAGTCGAGGTAACCGGCGGACCTGATGTCCCCTTCCACCCCGGGAGACAG
GTGAGGCTGGTCCCTTTTCTAATAAACCTTTTTAGTTGTATATTAGTTAAGAAGA
TGCAGTGTTTGTCGGAGGCTCATAAGTGTGGTTTGGAGAATTCATAACCTGTTCTTTGGCAAATACAGATTGCTTCGAACATGTGGCCTCTCAGTGAGACACACATCCTTGGTCTTATGT
TGGATATGTAAAAACTAATAATCAAGCCCTAGACTAATCCAACCCAAACCCAAGATTTTGGTAGGGTTTATTTAAGCAAAACTAACCCTATTGTCATCAGCCTGTCTACCATTGTACCTG
GGAAAGTGGTCTTGATGCTGACACATGTTTCCATTGTTTGATGGCCAGCTTATTTGTTAAATAGAGGATAAGCTTGTATAATTAGTAACTAGCTATGTACTGTGTGATGTATTATTTTAC
ATGGGGCATAAAATACTTGTAGTAGTTTATTGCCTAATACTCTTGCCTGGGAGCTGTAGACGATATAGTGCCGCGAGTGGGAATATGTTATTAGGCATCATTACTTTAGACTGTTGTTTC
TTTACTATATTTGTCTTGTAGCTACAGATGTTGATGAAAGCATTGTCTTTATTGTGTAGGACAAGCCTGAGCCTCCACCGGAAGGTCGCCTTCCTGGTGCCACCCAAGGT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGAAGGCTTACCCCACGGTGAACGAGGACTACCTCAAGGCGGTCGACAAGGCCAAGCGCAAGCTCCGCGGCCTCATCGCCGAGAAGAATTGCGCCCCGCTCATGCTCTGCCTCGCA
TGGCACTCCGCGGGCACCTCCGATGTGGCCACCAAAACCGGGGGGCCCTTCGGCACCATGAAGAACCCCGCCGAGCAGGCACACGGAGCCAACGTCGGGCTAGAAATTGCAGTCAGGCTG
CTATAGCCCATCAAGGAGCAGTTCCCCATCCTATCCTACATTGACTTCTACCAG
CTTGCTGGAGTCGTGGCAGTCGAGGTAACCGGCGGACCTGATGTCCCCTTCCACCCCGGGAGACAG
GACAAGCCTGAGCCTCCACCGGAAGGTCGCCTTCCTGGTGCCACCCAAGGT

Retrieve as FASTA