Entry information : ZmPrx[P]23 (GRMZM2G050829 [6a])
Entry ID 8010
Creation 2011-02-18 (Christophe Dunand)
Last sequence changes 2011-02-18 (Christophe Dunand)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2015-07-01 (Christophe Dunand)
Peroxidase information: ZmPrx[P]23 (GRMZM2G050829 [6a])
Name (synonym) ZmPrx[P]23 (GRMZM2G050829 [6a])
Class Class III peroxidase     [Orthogroup: Prx002]*
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrx[P]23
start..stop
S start..stop
ZmPrx22 639 0 1..338 1..338
ZmPrx146 639 0 1..338 1..338
ZmPrx87 574 0 42..338 44..340
ZmPrx[P]22 564 0 42..338 46..335
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 85856390..85856458 69 N° 2 85856467..85857360 894  
join(85856390..85856458,85856467..85857360)


exon

Literature and cross-references ZmPrx[P]23 (GRMZM2G050829 [6a])
Protein sequence: ZmPrx[P]23 (GRMZM2G050829 [6a])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   338 (313)
PWM (Da):   %s   35432.69 (32868.4)  
PI (pH):   %s   7.13 (6.85) Peptide Signal:   %s   cut: 26 range:26-338
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRSTWLAFALSALVVVSSSAAHAHASPxxxxxxxxxxxxxxAEDIVRHAVRRGIAREPGIGARLIRMHFHDCFVRGYDGSILINSTPGNKAEKDSVANNPNMRGFDIIDDAKAVLEAHCPRTVSCADIVAFAARDSTYLAGGLDYKVSSGRRDGRVSKEEEVLDNNVPAPTDEVDELIKSFKRKGLNADDMVTLSGAHTIGRSHCSSFMQRLYNFSGQLGQTDPSLDPVYAGHLKARCHWPSSDDQMDPTVVPLDPVTPATFDNQYYKNVLAHKVLFISYNTLLDNPWTAGMVHFNAAVEKAWQVKFAKAMVKMGKVQVLTGDEGEIREKCFAVNPHY

Retrieve as FASTA  
Remarks Pseudogene (chromo 10). Frame shift and missing sequence in the PS. Incorect prediction from Phytozome : 272 aa seq.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGTCCACTTGGTTGGCATTTGCCTTGTCGGCGCTCGTCGTCGTCTCCTCATCAGCGGCACACGCACACGCCTCGCCGAGGACATCGTGCGCCACGCCGTCCGCCGCGGTATCGCCC
GTGAGCCCGGCATAGGCGCGAGGCTCATCCGGATGCACTTCCACGACTGCTTCGTCCGGGGCTACGACGGCTCCATCCTCATCAACTCCACGCCGGGCAACAAGGCCGAGAAGGACTCCG
TGGCCAACAACCCCAACATGCGCGGCTTTGACATCATCGACGACGCCAAGGCCGTCCTCGAGGCGCACTGCCCGCGCACCGTCTCCTGCGCCGACATCGTCGCGTTCGCGGCCCGTGATA
GCACCTACCTCGCCGGCGGCCTGGACTACAAGGTCTCGTCTGGCCGCCGTGACGGTCGCGTGTCCAAAGAGGAGGAGGTGCTCGACAACAATGTCCCCGCCCCGACTGACGAGGTCGACG
AGCTCATCAAGAGCTTCAAGCGCAAGGGGCTCAACGCCGACGACATGGTCACGCTCTCCGGCGCGCACACCATCGGCCGCTCCCACTGCTCCTCCTTCATGCAGCGGCTCTACAACTTCA
GCGGGCAGCTGGGGCAGACGGACCCATCCCTCGACCCCGTCTACGCCGGGCACCTCAAGGCGCGGTGCCATTGGCCGTCCAGCGACGACCAGATGGATCCCACGGTGGTTCCGCTTGACC
CAGTCACGCCGGCGACCTTCGACAACCAGTACTACAAGAACGTGCTGGCACACAAGGTCCTGTTCATCTCCTACAACACACTGCTCGACAACCCATGGACGGCCGGAATGGTCCACTTCA
ACGCCGCAGTCGAGAAGGCATGGCAGGTCAAGTTCGCCAAGGCCATGGTTAAGATGGGCAAGGTCCAGGTGCTCACCGGGGACGAGGGAGAGATCAGGGAGAAGTGCTTCGCCGTCAACC
CACACTACTAG

Retrieve as FASTA