Entry information : EgrPrx93(Eucgr.F03025 / Egrandis_v1_0.014915m)
Entry ID 8021
Creation 2011-02-04 (Christophe Dunand)
Last sequence changes 2011-02-04 (Qiang Li)
Sequence status complete
Reviewer Catherine
Last annotation changes 2022-03-28 (Catherine )
Peroxidase information: EgrPrx93(Eucgr.F03025 / Egrandis_v1_0.014915m)
Name EgrPrx93(Eucgr.F03025 / Egrandis_v1_0.014915m)
Class Class III peroxidase    [Orthogroup: Prx022]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrPrx93
start..stop
S start..stop
EglPrx93 820 0 1..399 1..399
EcamPrx93 813 0 1..399 1..399
EguPrx93 800 0 1..399 1..399
VvPrx95 464 4.49e-164 4..400 10..369
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '8021' 'join(39812540..39812905,39813323..39813511,39813632..39813797,39813949..39814427)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 39812540..39812905 364 N° 2 39813323..39813511 187 N° 3 39813632..39813797 164 N° 4 39813949..39814427 477
join(39812540..39812905,39813323..39813511,39813632..39813797,39813949..39814427 )


exon

Literature and cross-references EgrPrx93(Eucgr.F03025 / Egrandis_v1_0.014915m)
DNA ref. Phytozome 12:   scaffold_6 (39812540..39814427)
Protein sequence: EgrPrx93(Eucgr.F03025 / Egrandis_v1_0.014915m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   399 (378)
PWM (Da):   %s   43871.61 (41369.2)  
PI (pH):   %s   4.91 (4.82) Peptide Signal:   %s   cut: 22 range:22-399
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MDWIKKLSLLTVLLCIYIALTNPNADTMRKNSPSVLWFPPPSRFTRNLSSRLMSWPQPYDGYLNGVDSATRDSAESLEYDYYRESCPQAEKIIRETVRQIYGVHSGVAPALLRLVFHDCF
IKGCDASVLLDSTEVMNAEKDTPPNETLKGFDVIDVIKAEIEEVCPSVVSCADILVLAAREGLLMAGGPFYPLSTGRRDSTHSYADLATYQLPSPYGDLSDTIASFGSRGFDEREIVNLL
GAHSIGVIHCKSFQSRLYNFSGTNEPDPSLDVGFLDLMRSKCSKSVSASPSLSPAPSSSQSSFDFSSLTSEEPGEVMNYEGPSSGFGTLYYHRLLQGKGVLYADQQLMVGEETGSWVRAY
ASDVSLFRRDFAETMMKLSNLQVLTAPNGQVRHSCSKAA*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction from phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGACTGGATCAAGAAACTGAGCCTCCTCACGGTCTTGCTCTGCATCTACATTGCCCTCACCAACCCGAATGCCGATACCATGAGGAAGAACTCACCCTCGGTTCTCTGGTTCCCGCCT
CCCTCGCGCTTCACTAGGAATCTCTCGTCTCGGTTGATGTCATGGCCTCAACCGTACGACGGCTACCTCAATGGAGTTGACTCGGCGACGCGTGACTCAGCTGAGTCGCTCGAGTACGAT
TACTATCGCGAGTCGTGCCCACAAGCCGAAAAGATCATCCGAGAGACAGTCCGGCAAATCTACGGTGTTCATTCGGGTGTCGCTCCCGCTCTGTTGCGGCTTGTCTTTCACGACTGCTTC
ATCAAG
AGGTGATTGCCACTCTGATATGTCATTGTCTGCCGAAAGGGGTTAGGGCTTCTAATTTCTTTGTTAATTTGATTATAGTATCTTAGTATGTTCCTGGTCGCGAGTTCTAATTAC
TGTGTTTCGAAGAATTCTTTCGTAATGCTATTGTCTATGTTTATGTTGTTGCCCGTATTTGGTGTTTTTGATACTGACTGTGAAGTCAATAGTGGGGTTTTGCTCCATGTTTATATCGCT
GTGTTTCTTTAGCGATTCGGGTATAGTTGCAGCCATTGGAAATTCCACTCCTGTTGGGTGTGTTTTTCATGAATCTTCGTATTGTTTTCCTTTTGATTTTTGGGTCTTTTTCAATTCATT
CCTTTGATCGTAGACGTGACCATCTGACATTTGTAATATCTCCTGCCGAGACGAAACTGACGCAGGGATGCGATGCTTCTGTTTTGTTGGACTCGACCGAAGTGATGAACGCAGAGAAAG
ATACGCCTCCAAATGAGACACTGAAGGGTTTTGACGTCATCGACGTCATCAAGGCCGAGATCGAAGAGGTCTGCCCCAGTGTCGTATCGTGCGCGGACATTCTTGTTTTGGCGGCCAGAG
AAGGCCTTCTCATG
TGGTAATTCTCTCCACCAGGATACTGCAACGTGCACATCTCCACAAATGCGATAAAACGTCGTTCAAATTTCTGACGGAATCCAAATTTGAGATTTTTGCGTACTG
AGTTGTGGAATTTCAGGCTGGAGGTCCATTCTATCCCCTGAGCACTGGTAGAAGAGACAGCACGCATTCATACGCAGATCTAGCGACTTATCAGCTTCCTTCACCATATGGAGATCTCTC
CGACACAATCGCATCTTTTGGATCAAGAGGATTCGATGAAAGAGAGATTGTCAATCTGCTCG
CGGTATCTTGCTTATCTTGATTTTTTTGCTCGCGTAATAAATGTTTCCAAGCTTAGTA
ACTCCTTATTATGAAGTGGCCAATTTCTGAAACTAGCATTTATGTGGATGCAATCAATGGTTGCACTAGATTAACTCAAATTTGATATGTTTCAGGAGCTCACAGCATCGGAGTTATTCA
CTGCAAATCGTTCCAGAGTCGTCTCTACAATTTTTCCGGGACTAATGAGCCTGACCCATCTCTAGATGTTGGATTCCTCGACCTAATGAGATCCAAATGCAGCAAGAGTGTCTCAGCGTC
TCCATCGCTGTCTCCAGCTCCATCATCATCCCAAAGCTCGTTTGACTTCTCGAGTTTGACATCTGAAGAGCCCGGTGAAGTGATGAACTATGAGGGGCCGAGTTCTGGTTTCGGGACTCT
GTACTACCATAGGCTGCTGCAAGGTAAAGGGGTTCTCTATGCGGATCAACAGCTCATGGTGGGAGAAGAAACGGGGAGTTGGGTCAGAGCATACGCCTCAGATGTCTCTTTGTTTCGCAG
AGATTTTGCTGAGACCATGATGAAGCTGTCGAACCTCCAAGTCCTAACTGCTCCTAATGGTCAGGTTCGACACAGTTGTTCAAAGGCTGCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGACTGGATCAAGAAACTGAGCCTCCTCACGGTCTTGCTCTGCATCTACATTGCCCTCACCAACCCGAATGCCGATACCATGAGGAAGAACTCACCCTCGGTTCTCTGGTTCCCGCCT
CCCTCGCGCTTCACTAGGAATCTCTCGTCTCGGTTGATGTCATGGCCTCAACCGTACGACGGCTACCTCAATGGAGTTGACTCGGCGACGCGTGACTCAGCTGAGTCGCTCGAGTACGAT
TACTATCGCGAGTCGTGCCCACAAGCCGAAAAGATCATCCGAGAGACAGTCCGGCAAATCTACGGTGTTCATTCGGGTGTCGCTCCCGCTCTGTTGCGGCTTGTCTTTCACGACTGCTTC
ATCAAG
GGATGCGATGCTTCTGTTTTGTTGGACTCGACCGAAGTGATGAACGCAGAGAAAGATACGCCTCCAAATGAGACACTGAAGGGTTTTGACGTCATCGACGTCATCAAGGCCGAG
ATCGAAGAGGTCTGCCCCAGTGTCGTATCGTGCGCGGACATTCTTGTTTTGGCGGCCAGAGAAGGCCTTCTCATG
GCTGGAGGTCCATTCTATCCCCTGAGCACTGGTAGAAGAGACAGC
ACGCATTCATACGCAGATCTAGCGACTTATCAGCTTCCTTCACCATATGGAGATCTCTCCGACACAATCGCATCTTTTGGATCAAGAGGATTCGATGAAAGAGAGATTGTCAATCTGCTC
G
GAGCTCACAGCATCGGAGTTATTCACTGCAAATCGTTCCAGAGTCGTCTCTACAATTTTTCCGGGACTAATGAGCCTGACCCATCTCTAGATGTTGGATTCCTCGACCTAATGAGATCC
AAATGCAGCAAGAGTGTCTCAGCGTCTCCATCGCTGTCTCCAGCTCCATCATCATCCCAAAGCTCGTTTGACTTCTCGAGTTTGACATCTGAAGAGCCCGGTGAAGTGATGAACTATGAG
GGGCCGAGTTCTGGTTTCGGGACTCTGTACTACCATAGGCTGCTGCAAGGTAAAGGGGTTCTCTATGCGGATCAACAGCTCATGGTGGGAGAAGAAACGGGGAGTTGGGTCAGAGCATAC
GCCTCAGATGTCTCTTTGTTTCGCAGAGATTTTGCTGAGACCATGATGAAGCTGTCGAACCTCCAAGTCCTAACTGCTCCTAATGGTCAGGTTCGACACAGTTGTTCAAAGGCTGCTTGA

Retrieve as FASTA