Entry information : EgrPrx96 (Eucgr.F04195 / Egrandis_v1_0.017803m)
Entry ID 8025
Creation 2011-02-04 (Christophe Dunand)
Last sequence changes 2011-02-04 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2013-10-30 (Qiang Li)
Peroxidase information: EgrPrx96 (Eucgr.F04195 / Egrandis_v1_0.017803m)
Name (synonym) EgrPrx96 (Eucgr.F04195 / Egrandis_v1_0.017803m)
Class Class III peroxidase    [Orthogroup: Prx004]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type Xylem
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrPrx96
start..stop
S start..stop
EglPrx96 721 0 1..350 1..350
EcamPrx96 717 0 1..350 1..350
EcamPrx97 640 0 1..350 1..350
EglPrx97 640 0 1..350 1..350
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 50191193..50191426 234 N° 2 50190261..50190455 195 N° 3 50188288..50188911 624  
complement(join(50188288..50188911,50190261..50190455,50191193..50191426))


exon

Literature and cross-references EgrPrx96 (Eucgr.F04195 / Egrandis_v1_0.017803m)
Literature Qiu,D., Wilson,I., Gan,S., Washusen,R., Moran,G. and Southerton,S. Gene expression in Eucalyptus branch xylem deficient in G-layer enriched tension wood
DNA ref. Phytozome 12:   scaffold_6 (50191426..50188288)
EST ref. GenBank:   EW688448.1 [5' end]
Protein sequence: EgrPrx96 (Eucgr.F04195 / Egrandis_v1_0.017803m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   351 (324)
PWM (Da):   %s   38203.31 (35314.8)  
PI (pH):   %s   5.26 (4.91) Peptide Signal:   %s   cut: 27 range:27-350
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASRFSSFVLVSFLVIAASHVHVTSSAHLVKGLSWSFYEKSCPKVESVIKKHLKKVFEEDIGQAAGLLRLHFHDCFVKGCDASVLLDGSASGPSEQDAPPNRSLRPSAFKIIDDLRELVDKKCGRVVSCADIAAIAARDSVVLSGGPEYDVPLGRRDGLTFATQNVTLENLPAPTENASAILSALAKKNLDATDVVALSGGHTIGLGHCTSFENRLYPTQDPTMEKTFAHDLKGVCPTTNSTNTTVLDIRSPNRFDNKYFVDLVNRQGLFTSDQDLYEDPATRDIVTSFAEDQELFFEKFVLAMTKMGQFGLLTGTKGEIRANCSVRNSENPDLLKSVVEEDLESYAELK*

Retrieve as FASTA  
Remarks Complete sequence from genomic and 1 EST. which is close to record Eucgr.L02740 (Egrandis_v1_0.017838m) (scaffold_1315 (6279..3264) complement(join(3264..3887,5113..5307,6046..6279) )in phytozome. Correct prediction from phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTCCCGTTTCAGCTCTTTCGTTTTGGTTTCTTTTCTTGTGATAGCTGCATCACATGTTCATGTTACGAGCTCTGCTCACTTGGTGAAGGGGCTCTCGTGGTCCTTCTACGAGAAG
AGCTGTCCCAAGGTGGAGTCCGTCATCAAGAAACATCTCAAGAAGGTGTTCGAGGAGGATATTGGCCAAGCTGCTGGGCTGCTTCGTCTGCACTTCCATGACTGCTTTGTTAAG
GTAGGT
ACCCAGCGAGCTCCGTCACAATCCGCATTCACTCTAACGGGGCAAAGAGATTTGCGATTTTCTTAGAAGTTGTATCTTGATTTGCTCATCACATGTCCTTGTGTAAGATGGTAAAGCTGA
TCGTTAAACGTTCACACACACTTTTTGGCAAGATGTGTGATCATCTTCACCAAAATAGACGAGAATAAGAAATGAGAGATGCCAACAAAAAACGAAAAAATCTTCTCGAGCTGGTGGCCT
AGTTTAGCAGCTGCAAGAAGTGGACTTTAAAAAAAAAAAAAAAAATTCATGATGCTGGGTAGATTACGAAGTCATGTGGGTGCCTGAAGCCATCGTCACTTCGTCTTTAGCATACAAATA
TTACTGTCTTATAGTAAACACTTGTTGAAGTTTTGGAGGATGCTTTTTGAGCGTTTGACATAGTTGGTCCTGATCTTTAGTGCTTTATATGCTAAAATGAAGAACATAGAAGTTCACAGA
ACTCCCATGTTCTGCTGTTATAAAGAGCTGCAGTAATAATTTCTGGTAAATTGTCTTCATAAGATGATTGCACGAGCAGTCTAGTTAAGCCCGGATTGTGTGGGGCGAGGATTTTTTTCA
CTTTGAAGGTTAGGATGGGTTTAAGTCATCACGGTTTCTTTTACAATTGAATCTTGATCACTTACATTCAAATAAATGATAAAATATTCTTCAAATTCACGCTTATTTTTTAGATCTGAT
GAGTGATGCAGGGATGTGATGCTTCGGTGTTGCTGGATGGATCAGCCAGTGGACCAAGTGAGCAGGACGCTCCACCGAACCGGAGCTTGAGACCATCAGCATTCAAGATCATCGATGACC
TCCGTGAGCTCGTGGACAAGAAGTGTGGTCGAGTAGTCTCTTGTGCTGATATCGCAGCCATTGCTGCTCGTGACTCCGTTGTCCTG
GTAAGCCCCCCTTAAGCTATCATTCCATCATCAC
TAGAGAGTAACACACCAAAACAGAGTTCTGACTATGATACTTGCCACGTACAAACCATTTAGGCATTCTTGAGCTCATACTATCAAAAATTTGATAGAAATACAGATTCTTGCCGAACAT
GCTCGTCCCTGTAAATAGTACTGATTTGCAGTCTGTATGATGCTTTTGCATTTGGTGGTGGGAAGGCAATTATGATCATAAGCTTTCAAAATAGAGCAACAGCAGAAAACAGTATCGGTC
AGTTAGCTAGCTTCCTAGATAATTGTAACAGTTCTTATGTTCAAGTTGATAAATGGATTTCCTTTTAGGGATTAATTGGATTATTAAACTAACCAAACATATAGTAAGTTACCCGTTCAC
ATAGAATTTTCACTGATTGGAAGTTCCCCCTCTGTTAAACATTCAACCACCCCATTAATCTACTGTTTTTGGAAATCAAGTTGATGTATAAAATACCCCAAACCTAACAGAATGTGCGCG
TTCGCAACATGGTACCTGGAACTTTGATCTCGGTCATGTGGCCATGCGATGACAAGGGTTGTTTAACCACTCTTGTTTAGGCTCAGGCTTGATTGTACTCATTAGTTATGGTGATAATTA
TACTTTATTGCTCTCTCAATGGTAATGTTCGATGATGCTTGGTAAGAGGAATTATAAATCATGAGAAAGTGGACTCGCTGATGTAACCAAGCGTGGTTAAACTATATCTGGATTCTTGTA
GTTTCCTCCTGTTCGTGTTCTGAATATCTTGTGAGATGTAGCAGATGTCCATGTAAGTCGGCAGCATTATCTTGGAAACTCAGGACAATTAACCCTGTCATTATGAGCCAAAGAGTGTAG
TATACAGCAAATTTCAATGGTCAAAACTGAGACATCGTCGTTGTTTATATCTGAGTTTTAACGGGTAGTCATCACCATTTTTTTAAGATCCCAACCAGTCGGAGGTCTATTCTGAATTTT
GGGATCATGTTTATGGATAAAATACTGCAACTTGAAATGTCTTTGGACTCTTTCAACATGGTCAGGTAAGCACGTGCTCACAAAGTTCTTGGAAATTGCAGATGAAATGACAACCTAGGT
AGACGATTCTGTTTGATGATAATCTAATCCCAACTAGCTTCTAGTTTATGAGAGTTGACTTGCAAATGATCACCTCCACACGAAGAAGACTATCAAATTCTCCGTTGGCTTCATGTCCTA
TACATCATTGAAGTTTTCTCAATTATGATTACTATTGTTCATCATATCAATGAGCATCAACAGATGTTTTCCGAGTTCTGGATTCTAATTCTGTTATTCTTGTCGTCGTGTGCAGTCAGG
CGGACCTGAGTATGATGTGCCGTTGGGAAGGCGGGATGGACTCACGTTTGCGACTCAAAATGTGACCTTAGAGAATTTACCTGCACCAACTGAGAACGCCAGTGCAATTCTCTCCGCCCT
AGCCAAGAAAAACTTAGACGCTACCGACGTGGTGGCCCTCTCTGGAGGCCACACCATCGGGCTTGGGCACTGCACCTCCTTTGAGAATCGGCTCTACCCGACCCAAGACCCCACGATGGA
GAAGACCTTTGCCCATGATCTCAAGGGCGTGTGCCCCACCACAAACTCCACCAACACTACGGTCTTGGACATCCGATCACCCAACCGATTCGACAACAAGTACTTTGTCGATTTGGTGAA
CCGCCAAGGCCTGTTCACCTCAGACCAAGATCTGTATGAGGATCCTGCAACGAGGGACATTGTCACTAGCTTTGCCGAGGACCAGGAATTGTTCTTTGAGAAGTTTGTCCTAGCCATGAC
GAAGATGGGGCAATTCGGCTTGTTGACGGGGACGAAAGGAGAAATCCGAGCCAACTGCTCAGTCAGGAATTCTGAGAACCCCGATCTCTTGAAGTCCGTGGTGGAAGAGGACCTGGAGAG
CTATGCTGAATTGAAATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTCCCGTTTCAGCTCTTTCGTTTTGGTTTCTTTTCTTGTGATAGCTGCATCACATGTTCATGTTACGAGCTCTGCTCACTTGGTGAAGGGGCTCTCGTGGTCCTTCTACGAGAAG
AGCTGTCCCAAGGTGGAGTCCGTCATCAAGAAACATCTCAAGAAGGTGTTCGAGGAGGATATTGGCCAAGCTGCTGGGCTGCTTCGTCTGCACTTCCATGACTGCTTTGTTAAG
GGATGT
GATGCTTCGGTGTTGCTGGATGGATCAGCCAGTGGACCAAGTGAGCAGGACGCTCCACCGAACCGGAGCTTGAGACCATCAGCATTCAAGATCATCGATGACCTCCGTGAGCTCGTGGAC
AAGAAGTGTGGTCGAGTAGTCTCTTGTGCTGATATCGCAGCCATTGCTGCTCGTGACTCCGTTGTCCTG
TCAGGCGGACCTGAGTATGATGTGCCGTTGGGAAGGCGGGATGGACTCACG
TTTGCGACTCAAAATGTGACCTTAGAGAATTTACCTGCACCAACTGAGAACGCCAGTGCAATTCTCTCCGCCCTAGCCAAGAAAAACTTAGACGCTACCGACGTGGTGGCCCTCTCTGGA
GGCCACACCATCGGGCTTGGGCACTGCACCTCCTTTGAGAATCGGCTCTACCCGACCCAAGACCCCACGATGGAGAAGACCTTTGCCCATGATCTCAAGGGCGTGTGCCCCACCACAAAC
TCCACCAACACTACGGTCTTGGACATCCGATCACCCAACCGATTCGACAACAAGTACTTTGTCGATTTGGTGAACCGCCAAGGCCTGTTCACCTCAGACCAAGATCTGTATGAGGATCCT
GCAACGAGGGACATTGTCACTAGCTTTGCCGAGGACCAGGAATTGTTCTTTGAGAAGTTTGTCCTAGCCATGACGAAGATGGGGCAATTCGGCTTGTTGACGGGGACGAAAGGAGAAATC
CGAGCCAACTGCTCAGTCAGGAATTCTGAGAACCCCGATCTCTTGAAGTCCGTGGTGGAAGAGGACCTGGAGAGCTATGCTGAATTGAAATGA

Retrieve as FASTA