Entry information : EgrPrx133 (Eucgr.I00020 / Egrandis_v1_0.019276m)
Entry ID 8037
Creation 2011-02-04 (Christophe Dunand)
Last sequence changes 2011-02-09 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2013-10-30 (Qiang Li)
Peroxidase information: EgrPrx133 (Eucgr.I00020 / Egrandis_v1_0.019276m)
Name (synonym) EgrPrx133 (Eucgr.I00020 / Egrandis_v1_0.019276m)
Class Class III peroxidase    [Orthogroup: Prx026]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrPrx133
start..stop
S start..stop
EglPrx133 681 0 1..327 1..327
EcamPrx133 672 0 1..327 1..327
EguPrx133 665 0 1..327 1..327
RcPrx53 509 0 11..327 3..315
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 255362..255613 252 N° 2 255770..255958 189 N° 3 256061..256223 163 N° 4 256688..257067 380
join(255362..255613,255770..255958,256061..256223,256688..257067)


exon

Literature and cross-references EgrPrx133 (Eucgr.I00020 / Egrandis_v1_0.019276m)
DNA ref. Phytozome 12:   scaffold_9 (255362..257067)
Protein sequence: EgrPrx133 (Eucgr.I00020 / Egrandis_v1_0.019276m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   328
PWM (Da):   %s   35788.37 Transmb domain:   %s   i12-34o
PI (pH):   %s   5.74
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MARMTNRAAVDVMWGVMLLMQMMGLIRSFNFGIGGVDGLRMDYYFMSCPFAEQIVWNSVTSALQSDPTLAAGLLRMHFHDCFIQGCDGSVLLDSTKDNTAEKDSPANLSLRGYEVIDDAKEQIEEQCPGVVSCADILAMAARDAVFWAGGPRYEIPKGRKDGARSRIEDTINLPSPTFNASELIRMFGQHGFSAQEMVALSGGHTLGVARCSSFKQRLSNSDPTLDSSFAKTLSKTCSAGDNAEQPFDATRNTFDGAYYYGLVNKVGVLTSDQTLFASARTKGIVNGYAMNQAMFFFDFQQAMLKMSLLDVKEGSAGQVRLNCRKIN*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction from phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGAGGATGACGAATAGAGCTGCGGTGGACGTGATGTGGGGGGTGATGTTGTTGATGCAGATGATGGGGTTGATCAGGTCGTTCAATTTCGGGATAGGAGGAGTCGACGGGCTGAGA
ATGGACTACTACTTCATGTCCTGCCCCTTCGCCGAGCAGATTGTCTGGAACTCCGTCACCTCCGCCCTCCAGTCCGACCCTACGCTTGCTGCCGGCCTCCTTCGCATGCATTTCCACGAC
TGCTTCATTCAG
GTATTCCACTCCAACCCTCGAGTTACCGCATGTATGCGTACACACACATAGTTTAAATATACACAAAACGAGCTCATCACGTGGATCGATATATGTGGGCAATGACTT
TCTGTGCTGCTTGTTGAGCCTGAACATGGACTTTATGCGCGTGTACAGGGATGCGATGGGTCGGTGTTGCTAGATTCGACCAAGGACAACACCGCAGAGAAAGACTCGCCCGCGAACTTA
AGCTTGAGAGGGTACGAAGTGATCGACGATGCGAAGGAGCAGATCGAAGAGCAATGCCCGGGCGTCGTCTCCTGCGCCGATATCTTGGCCATGGCCGCCAGAGATGCTGTGTTCTGG
GTA
ATATTTTCAGCCTACATCCGTCATGAGCGCAAGCCTCAGTCACCCCCCTCCTCTCACTCTCCTCTTTCAACTCCCCTGACGTAACCATATGAATTACAGGCGGGAGGTCCAAGATACGAA
ATACCGAAAGGGAGGAAGGACGGAGCGAGATCGAGGATAGAGGACACCATCAACCTCCCGTCTCCCACCTTCAACGCCTCCGAACTCATTCGCATGTTCGGACAGCACGGCTTCTCCGCC
CAAGAGATGGTCGCTCTGTCCG
GTATTCGATCGCTTCTCTCTTTTTCTCAGCCCGAGTTATCCTGTACCTAACATGCATCTATATTCAAGCAATATGTTTACATGGTCTAATGTAACAAG
AAACCTTCACATCAATCCAAATCAATCCTCGCATGCAAAAAGCTATTCAATGAAAACTTCACGCACTGAGTCGTAAATCATCTCTCGAGCATCCAATGCTATCTACAGGAGTGACCGACA
CTCTAGAACATAGATGGCATGACCCACAAAGACTGATTAAATGTAGTAGCTAAGGGTCGATGAAAGGTGCAGACAAGCTAATTTGTCTTGTTTTAGGTCACGCAAATCTTTGATCTAGGA
TCGCCTTCCCTTTACATCAATAATTTATCAAAGGCACTGCTCCCATAAATCATGCAAAAACATGTACAAGCAAATCATGGAGCGGATCGTGTCTTTCGCTAATTTGTAATCAATTGAGTC
CGATAGGTGGACACACGTTGGGAGTGGCAAGGTGCTCGTCGTTCAAGCAAAGGCTGAGCAACTCCGACCCGACCCTCGACTCCAGCTTCGCCAAGACGCTGTCCAAGACGTGCAGCGCCG
GGGACAACGCAGAGCAGCCCTTCGACGCCACGCGGAACACCTTCGACGGCGCCTACTACTACGGCCTCGTCAACAAGGTGGGCGTGCTGACGTCGGACCAGACCCTGTTCGCCAGCGCCC
GGACCAAAGGGATTGTGAACGGGTACGCCATGAACCAGGCCATGTTCTTCTTCGACTTCCAGCAGGCCATGCTCAAGATGAGCCTGCTCGACGTCAAGGAAGGCTCCGCCGGCCAGGTCC
GTCTCAATTGTCGCAAGATCAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGAGGATGACGAATAGAGCTGCGGTGGACGTGATGTGGGGGGTGATGTTGTTGATGCAGATGATGGGGTTGATCAGGTCGTTCAATTTCGGGATAGGAGGAGTCGACGGGCTGAGA
ATGGACTACTACTTCATGTCCTGCCCCTTCGCCGAGCAGATTGTCTGGAACTCCGTCACCTCCGCCCTCCAGTCCGACCCTACGCTTGCTGCCGGCCTCCTTCGCATGCATTTCCACGAC
TGCTTCATTCAG
GGATGCGATGGGTCGGTGTTGCTAGATTCGACCAAGGACAACACCGCAGAGAAAGACTCGCCCGCGAACTTAAGCTTGAGAGGGTACGAAGTGATCGACGATGCGAAG
GAGCAGATCGAAGAGCAATGCCCGGGCGTCGTCTCCTGCGCCGATATCTTGGCCATGGCCGCCAGAGATGCTGTGTTCTGG
GCGGGAGGTCCAAGATACGAAATACCGAAAGGGAGGAAG
GACGGAGCGAGATCGAGGATAGAGGACACCATCAACCTCCCGTCTCCCACCTTCAACGCCTCCGAACTCATTCGCATGTTCGGACAGCACGGCTTCTCCGCCCAAGAGATGGTCGCTCTG
TCCG
GTGGACACACGTTGGGAGTGGCAAGGTGCTCGTCGTTCAAGCAAAGGCTGAGCAACTCCGACCCGACCCTCGACTCCAGCTTCGCCAAGACGCTGTCCAAGACGTGCAGCGCCGGG
GACAACGCAGAGCAGCCCTTCGACGCCACGCGGAACACCTTCGACGGCGCCTACTACTACGGCCTCGTCAACAAGGTGGGCGTGCTGACGTCGGACCAGACCCTGTTCGCCAGCGCCCGG
ACCAAAGGGATTGTGAACGGGTACGCCATGAACCAGGCCATGTTCTTCTTCGACTTCCAGCAGGCCATGCTCAAGATGAGCCTGCTCGACGTCAAGGAAGGCTCCGCCGGCCAGGTCCGT
CTCAATTGTCGCAAGATCAACTGA

Retrieve as FASTA