Entry information : SbPrx84 (Sobic.005G011300.1 [2.1] / SB05G001010 [1.4])
Entry ID 806
Creation 2005-12-16 (Christophe Dunand)
Last sequence changes 2014-01-08 (Qiang Li)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-04 (Messaoudi)
Peroxidase information: SbPrx84 (Sobic.005G011300.1 [2.1] / SB05G001010 [1.4])
Name (synonym) SbPrx84 (Sobic.005G011300.1 [2.1] / SB05G001010 [1.4])
Class Class III peroxidase    [Orthogroup: Prx006]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SbPrx84
start..stop
S start..stop
SpPrx08 664 0 1..328 1..329
ZmPrx64 588 0 28..328 18..320
SbPrx83 580 0 28..328 31..331
SbPrx144 574 0 16..328 7..320
Gene structure Fichier Exons


exon

Literature and cross-references SbPrx84 (Sobic.005G011300.1 [2.1] / SB05G001010 [1.4])
Literature Cordonnier-Pratt,M.-M. et al., unpublished
DNA ref. Phytozome 12:   chromosome_5 (1019317..1021310)
Cluster/Prediction ref. PlantGDB:   SbGSStuc11-12-04.7718.1 UniGene:   Sbi.1435
Protein sequence: SbPrx84 (Sobic.005G011300.1 [2.1] / SB05G001010 [1.4])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   328 (296)
PWM (Da):   %s   34294.08 (31277.5) Transmb domain:   %s   i13-35o
PI (pH):   %s   7.98 (7.98) Peptide Signal:   %s   cut: 33 range:33-328
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAMATTDRASSSSAAALLLLLLALAVAGTSSAQLSTGFYSYSCPGVYGAVKSVMKSAIANEKRMGASIVRLFFHDCFVQGCDASLLLDDTATFQGEKMATPNNGSVRGFEVIDAVKSAVE
KVCPGVVSCADILAIAARDSVVILGGPSWDVKVGRRDSTTASFSGANNNIPPPTSGLANLTSLFAAQGLSQKDMVALSGAHTIGQARCTNFRAHIYNDTDINSAFAKTRQSGCPSTSGAG
DNNLAPLDLQTPTVFENNYYKNLLSKKGLLHSDQELFNGGATDTLVQSYVGSQSTFFTDFVTGMIKMGDITPLTGSNGQIRKNCRRVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 5, intron 3) and 22 ESTs.
DNA
Send to BLAST
CDS
Send to BLAST