Entry information : EgrAPx03 (Eucgr.B02456 / Egrandis_v1_0.024217m)
Entry ID 8061
Creation 2011-02-04 (Christophe Dunand)
Last sequence changes 2011-02-07 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2013-10-30 (Qiang Li)
Peroxidase information: EgrAPx03 (Eucgr.B02456 / Egrandis_v1_0.024217m)
Name (synonym) EgrAPx03 (Eucgr.B02456 / Egrandis_v1_0.024217m)
Class Ascorbate peroxidase    [Orthogroup: APx2001]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrAPx03
start..stop
S start..stop
EglAPx03 503 0 1..249 1..249
EguAPx03 502 0 1..249 1..249
EcamAPx03 498 0 1..245 1..245
CpapAPx02 478 4.56e-174 1..249 1..249
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '8061' 'join(46686446..46686564,46686676..46686850,46687008..46687073,46687546..46687594,46687676..46687758,46687868..46687947,46688076..46688178,46688278..46688336,46688500..46688515)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 46686446..46686564 117 N° 2 46686676..46686850 173 N° 3 46687008..46687073 64 N° 4 46687546..46687594 47
N° 5 46687676..46687758 81 N° 6 46687868..46687947 78 N° 7 46688076..46688178 101 N° 8 46688278..46688336 57
N° 9 46688500..46688515 14  
join(46686446..46686564,46686676..46686850,46687008..46687073,46687546..46687594 ,46687676..46687758,46687868..46687947,46688076..46688178,46688278..46688336,466 88500..46688515)


exon

Literature and cross-references EgrAPx03 (Eucgr.B02456 / Egrandis_v1_0.024217m)
DNA ref. Phytozome 12:   scaffold_2 (46686446..46688515)
Protein sequence: EgrAPx03 (Eucgr.B02456 / Egrandis_v1_0.024217m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   249
PWM (Da):   %s   27254.71  
PI (pH):   %s   5.19
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGKCYPTVSEEYSKAVEKCKKKLRGLIAEKNCAPLMLRLAWHSAGTYDVKTKTGGPFGTMKHAAELAHGANNGLDIAVRLLEPIKEQFPVLSYADFYQLAGVVAVEVTGGPEIPFHPGRE
DKPEPPPEGRLPDATKGSDHLRDVFGHMGLSDQDIVALSGGHTLGRCHKERSGFEGPWTTNPLIFDNTYFTELLTGDKEDLLQLPSDKALLTDPVFRPLVEKYAADEDAFFADYAEAHLK
LSELGFADA*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction from phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGAAGTGTTACCCGACCGTGAGCGAGGAGTACAGCAAGGCCGTTGAGAAATGCAAGAAGAAGCTCCGAGGCCTCATCGCCGAGAAGAACTGCGCTCCGCTCATGCTTCGTCTCGCG
CGTACCTCTCTCTCTCTCTCTCTCCCTCTCTCTCTCTCAGACCCAAAGTTCATTTGCGATCGACTGAAGTTCCGATCATGTGAATCGACCTTGCCGTGTGCTGTCCCTGCAGATGGCACT
CTGCCGGTACCTACGACGTGAAGACGAAGACAGGGGGTCCGTTTGGGACCATGAAGCATGCCGCTGAGCTCGCTCATGGCGCCAATAACGGACTCGACATAGCCGTGAGGCTGTTGGAGC
CCATCAAGGAGCAGTTTCCTGTCCTCTCTTACGCCGACTTCTATCAG
AGGTGAGACTACTTGCGGCCCGCAGCTGAAGGCGCTGCCTAGATCTGGACATGATACTTCCGTGTTGGGTTTT
TCAAAGTCCGATGCTGTGCCGGCTCGGAATCATGTACATACTAATGATTGTTTTGGTTGGACTGATTATGTCCTGATGCGTCGCAGTTGGCTGGTGTTGTTGCCGTGGAAGTCACCGGCG
GACCTGAAATTCCGTTCCACCCGGGAAGAGAG
AGGTCAGTGGAATTTTTTTTTTTTTTTTTTTGGTGCTGTCTTGATTAGCTTGATGTCCTGGGGATGCTGGCGCTGTGAAGTTCTTGAT
TCCAATTGACTGTCTTTTTCACAATTAAATTGTTAGGCGGCTTGGAGGCTTACTAGGGTTTTAGAAGTCTAAGATTTAAGTCTTCTTTTTGAGGGCTTGCTTGTTTTCTAAGAACAAATT
ATGTCTGTGTGGACTGATGTATCGAAGATAGGTTAATATAAGCTTTGGAGTTTGAATGTCATGCACTTTTCCTTGTGATGCTAGGCAATGTCGTGACACATTATCTTGTTCTTTATCTCA
CCTGCCTCCCCTGTGCCTTTTCTGTGTCAGTACTCTCGTGCTCTGCCTTTTATCCCACCAGTTTTCCCTGTAAAATGTTTTGCCAATGATTGATGATTGAATCCTAGTTCATGTTGTGAT
GATGGTGTTGTCATCTTAAACCACAGGATAAGCCGGAACCGCCTCCTGAGGGTCGTCTGCCTGATGCCACCAAGGGGGTTAGTTCGTCTTCCCTGCTTTAAAGAGCAAATCTCCATGTGA
GTGCTGCATTTTGCATGACAAATGCCTGATCTCCGCAGGCTCTGATCATTTGAGAGATGTGTTTGGTCACATGGGTTTGAGCGATCAGGATATTGTTGCTCTCTCTGGTGGCCATACCCT
G
TGGTTTGTATTTCAATTCTCTGGAACTTGGACTTCCGGTGCTTTCCACAAATTAAAGCAGCGTAGTGAATTCTGACTTCATGTACTCATTTTTCCTTTCGCTTCCATCCAGGGAAGATG
CCACAAAGAAAGATCTGGATTTGAGGGACCTTGGACTACCAATCCTCTCATTTTTGATAACACCTATTTCAC
ACGTGAGTTTCCTGGATTTATTTGTGCCGCGAATGGATTTGTATGCCT
GATGTGGAAGTATTTTATTGTACTACGACACGGTAGGACCTGGATAGCACTCCGAGTAAAAAGTGGCTTTTTTTTTTCTTAGGGAGCTATTGACCGGTGATAAGGAAGATCTCCTTCAGC
TGCCATCCGACAAGGCTCTTCTCACTGATCCCGTTTTCCGTCCACTTGTTGAAAAATATGCTGCG
CGGTGCGTACTTTCTCTTTTTGGCTGCTTTGACACAGTTCCTTTCAATCGGCAAC
TGCATCTACATATGCACTCTGTTTGAACATTGTTTTGCTCTTCCAGGATGAAGATGCCTTCTTCGCTGACTATGCGGAAGCTCACCTAAAACTCTCTGAACTTGGGGGTAACGATTATAT
CTCTATTCAGTCCCTTGCAACATGATACAAAAACTGTGCTTTTGACAATACTACGGCATGTTTTTGACCCCAAAAATATATAGATGCGCTGCGTGTTGAAGTAAGAGCAAATTCATTTAC
CGAGTTCTGGTTTGCTGAACTTTCTTGCAGATTTGCGGATGCCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGAAGTGTTACCCGACCGTGAGCGAGGAGTACAGCAAGGCCGTTGAGAAATGCAAGAAGAAGCTCCGAGGCCTCATCGCCGAGAAGAACTGCGCTCCGCTCATGCTTCGTCTCGCA
TGGCACTCTGCCGGTACCTACGACGTGAAGACGAAGACAGGGGGTCCGTTTGGGACCATGAAGCATGCCGCTGAGCTCGCTCATGGCGCCAATAACGGACTCGACATAGCCGTGAGGCTG
TTGGAGCCCATCAAGGAGCAGTTTCCTGTCCTCTCTTACGCCGACTTCTATCAG
TTGGCTGGTGTTGTTGCCGTGGAAGTCACCGGCGGACCTGAAATTCCGTTCCACCCGGGAAGAGAG
GATAAGCCGGAACCGCCTCCTGAGGGTCGTCTGCCTGATGCCACCAAGGGCTCTGATCATTTGAGAGATGTGTTTGGTCACATGGGTTTGAGCGATCAGGATATTGTTGCTCTCTCTGGT
GGCCATACCCTG
GGAAGATGCCACAAAGAAAGATCTGGATTTGAGGGACCTTGGACTACCAATCCTCTCATTTTTGATAACACCTATTTCACGGAGCTATTGACCGGTGATAAGGAAGAT
CTCCTTCAGCTGCCATCCGACAAGGCTCTTCTCACTGATCCCGTTTTCCGTCCACTTGTTGAAAAATATGCTGCG
GATGAAGATGCCTTCTTCGCTGACTATGCGGAAGCTCACCTAAAA
CTCTCTGAACTTGG
ATTTGCGGATGCCTAA

Retrieve as FASTA