Entry information : EgrPrx60 (Eucgr.B03091 / Egrandis_v1_0.045627m)
Entry ID 8063
Creation 2011-02-04 (Christophe Dunand)
Last sequence changes 2011-02-07 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-03-07 (Qiang Li)
Peroxidase information: EgrPrx60 (Eucgr.B03091 / Egrandis_v1_0.045627m)
Name (synonym) EgrPrx60 (Eucgr.B03091 / Egrandis_v1_0.045627m)
Class Class III peroxidase    [Orthogroup: Prx025]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrPrx60
start..stop
S start..stop
EglPrx60 712 0 1..344 1..344
EguPrx60 706 0 1..344 1..344
EcamPrx60 672 0 1..344 1..344
CroPrx18 532 0 17..339 1..324
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 55903033..55903272 240 N° 2 55902420..55902611 192 N° 3 55902104..55902266 163 N° 4 55900928..55901367 440
complement(join(55900928..55901367,55902104..55902266,55902420..55902611,5590303 3..55903272))


exon

Literature and cross-references EgrPrx60 (Eucgr.B03091 / Egrandis_v1_0.045627m)
DNA ref. Phytozome 12:   scaffold_2 (55903272..55900928)
Protein sequence: EgrPrx60 (Eucgr.B03091 / Egrandis_v1_0.045627m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   345 (313)
PWM (Da):   %s   37395.69 (33903.8)  
PI (pH):   %s   5.2 (4.79) Peptide Signal:   %s   cut: 32 range:32-344
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATSSPRSTPRFSKFLALFLLLGFGKTYCASDPPLTLDYYKSSCPSVLEIVRKEMECAVLSDPRNAALIIRLHFHDCFVQGCDGSVLLDDTITLQGEKKAPPSINSLGGFRIVDRIKNMLESECPGVVSCADILTVAARDATLLVGGPYWDVPLGRKDSRTAGYELASAIPTADESLPSIISKFLFQGLSVTDMVALAGAHTVGMARCENFRARIYGDFEATSGASPASEAYLGHLKSVCPPIGGGNNNVAPMDSVTPNLFDNSFYHLLLQGEGLLNSDQEMYSSILAVQTREIVKKYAADPIAFFQQFSESMVRMGNITNPESFVNGEVRKNCRFINTWAPEI*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction from Phytozome (PS is missing)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAACTTCATCGCCACGCTCGACGCCCCGATTTTCCAAATTCCTGGCTCTCTTTCTCTTGTTAGGCTTCGGCAAAACATATTGCGCCAGCGACCCTCCATTGACGTTGGATTACTAC
AAGTCGTCGTGTCCGTCAGTGCTCGAGATTGTGAGGAAGGAGATGGAATGTGCCGTGCTCTCTGACCCTCGCAATGCCGCATTGATCATTCGGTTGCATTTCCACGACTGCTTTGTTCAG
GTTCGTTTTCATTTTGTATAGTATTTTCACGTAGGCCGGACTAGCCACCTTTGCAAGCTTGCTAAGGTTTGAACTTTGTAGACACAATGGGTATTTCTATATTTGATTTCACGGGGAATG
ATGTGTCTCTGTCTTCGTAGATATATATACCTGATTCGGCCCAGTGAATGATTAATTTTCAAGAAGGGCTGCCACCAATCTCATTTTTACAGATCAACTTCATTATGTACATGCGAAAAT
GTCTTTCTACTAATTGTGCATTAAGCTGAGAGATTTGAATGTGGGAGACACGATCAATAAGTCTAGAGCTCGAGCTAGTAACCACGACTAGAATAAGATGAAGCTAACCAGAGGTTATTA
GAACTTGTAAAATCGTGATCGGTCCTTTGTTTTTCCCCTAACAATTGGGATACGAATATAGGGATGCGACGGGTCGGTTTTGCTAGATGACACTATCACGCTCCAAGGAGAGAAGAAAGC
TCCCCCCAGCATAAATTCTCTAGGAGGGTTCAGGATCGTCGACCGCATCAAGAACATGCTTGAATCCGAGTGCCCCGGAGTTGTCTCTTGCGCCGACATACTCACGGTTGCCGCAAGAGA
TGCTACGCTTTTG
GTATGTCCGCTAACTTTCGTCTCTTTTCAAGCATAAAAGCATTGATTGCTCCATTTCGTCATTCATGTCCTTATGCCATCGCTAGTCGTGGTGTTAAACTTAAGACG
AAGTTCTAATGCGATGATAAATTGTAATCTTTTGGATTTCGCCAAGGTTGGTGGACCTTATTGGGACGTACCCTTGGGAAGGAAGGACTCGAGGACAGCGGGCTACGAGCTCGCCTCCGC
CATCCCGACAGCCGACGAGAGCCTTCCGTCCATCATCTCCAAATTTCTCTTCCAAGGCCTCTCCGTCACCGACATGGTCGCTCTCGCCG
GTAAATTAACTAAGCTCAAGAATGTCCTATC
ATGCGATCGATTACGTGCTCTTTAAATAATTTTAATGTCCTATGATTTTGCTAACTTCTCGAGTGTCGGATGAATATGCTGATGGCTACATAATAGATTCCACCTCCAGACTGCAGATTG
ATGTTGTTATTGAATGCGACTTCGTGTAAAGCTAACTCTACCTAATATTTCCCCCAACCACATGTGCACCCGTCTCTAAAACGTCTTATTCTCCGGTCAAAATCAAATTCTCAAGGAAAA
ATATAATGTCCCTTATAAATTATGATGTATTTCTAAACATTTCATTTAGCCACGCCCACAAAAAAACAGAAATTTCAATTGTACATGACTGTTGAGTCTGTTCGGTCCTAATTAGATTCT
AGCTTCCTCTGGTAATAAAATATCAAGAAGAATCACGACGAGCGGAAAGGATAAGGCTTTAGCCTCAGGTAGCGTGGACCAATTCAAGATCGAATTTCCATTTTATTATCGAAATTTGTA
GTATCGTACACAAAAGGAGAGGCTAAAAAGCGATGCAAGGTTCATTAATCTGAGTGGAAGAAAAGAAAGATGAATCATCACGCAACATACGAAAGTGGAGACTTGCGGTCCATGTTATGG
ACATGTCGACTCTTCTTTGGCATGCTCTAACCTAACGAACGAAACCAATCATGTAGTGATGACAAATTTCTGCCCTTTTTCCAATTGATGGATGTGCATAATTAGGGGCTCACACGGTGG
GGATGGCACGGTGCGAGAATTTCCGAGCCCGGATCTACGGGGACTTTGAAGCGACATCCGGGGCCAGTCCTGCCTCAGAGGCGTACCTCGGCCACTTGAAGTCGGTCTGCCCCCCGATAG
GGGGAGGAAACAACAACGTCGCCCCTATGGATTCCGTGACCCCCAACCTGTTCGACAACTCCTTCTATCACCTGCTCCTACAGGGGGAGGGCCTGCTCAACTCGGACCAGGAAATGTACT
CGAGCATCCTGGCGGTCCAGACGAGGGAAATCGTGAAGAAGTACGCGGCCGACCCGATCGCCTTCTTTCAGCAGTTCTCGGAGTCGATGGTGAGGATGGGGAACATCACGAACCCGGAAA
GCTTCGTCAATGGGGAAGTGAGGAAGAACTGTAGGTTCATAAACACATGGGCTCCAGAGATCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAACTTCATCGCCACGCTCGACGCCCCGATTTTCCAAATTCCTGGCTCTCTTTCTCTTGTTAGGCTTCGGCAAAACATATTGCGCCAGCGACCCTCCATTGACGTTGGATTACTAC
AAGTCGTCGTGTCCGTCAGTGCTCGAGATTGTGAGGAAGGAGATGGAATGTGCCGTGCTCTCTGACCCTCGCAATGCCGCATTGATCATTCGGTTGCATTTCCACGACTGCTTTGTTCAG
GGATGCGACGGGTCGGTTTTGCTAGATGACACTATCACGCTCCAAGGAGAGAAGAAAGCTCCCCCCAGCATAAATTCTCTAGGAGGGTTCAGGATCGTCGACCGCATCAAGAACATGCTT
GAATCCGAGTGCCCCGGAGTTGTCTCTTGCGCCGACATACTCACGGTTGCCGCAAGAGATGCTACGCTTTTG
GTTGGTGGACCTTATTGGGACGTACCCTTGGGAAGGAAGGACTCGAGG
ACAGCGGGCTACGAGCTCGCCTCCGCCATCCCGACAGCCGACGAGAGCCTTCCGTCCATCATCTCCAAATTTCTCTTCCAAGGCCTCTCCGTCACCGACATGGTCGCTCTCGCCG
GGGCT
CACACGGTGGGGATGGCACGGTGCGAGAATTTCCGAGCCCGGATCTACGGGGACTTTGAAGCGACATCCGGGGCCAGTCCTGCCTCAGAGGCGTACCTCGGCCACTTGAAGTCGGTCTGC
CCCCCGATAGGGGGAGGAAACAACAACGTCGCCCCTATGGATTCCGTGACCCCCAACCTGTTCGACAACTCCTTCTATCACCTGCTCCTACAGGGGGAGGGCCTGCTCAACTCGGACCAG
GAAATGTACTCGAGCATCCTGGCGGTCCAGACGAGGGAAATCGTGAAGAAGTACGCGGCCGACCCGATCGCCTTCTTTCAGCAGTTCTCGGAGTCGATGGTGAGGATGGGGAACATCACG
AACCCGGAAAGCTTCGTCAATGGGGAAGTGAGGAAGAACTGTAGGTTCATAAACACATGGGCTCCAGAGATCTAG

Retrieve as FASTA