Entry information : EgrPrx61 (Eucgr.B03369 / Egrandis_v1_0.019151m)
Entry ID 8065
Creation 2011-02-04 (Christophe Dunand)
Last sequence changes 2011-02-07 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2013-10-30 (Qiang Li)
Peroxidase information: EgrPrx61 (Eucgr.B03369 / Egrandis_v1_0.019151m)
Name (synonym) EgrPrx61 (Eucgr.B03369 / Egrandis_v1_0.019151m)
Class Class III peroxidase    [Orthogroup: Prx003]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrPrx61
start..stop
S start..stop
EcamPrx61 683 0 1..329 1..329
EguPrx61 682 0 1..329 1..329
EglPrx61 626 0 1..329 1..329
PtPrx15 502 0 2..326 3..327
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 58556032..58556232 201 N° 2 58556674..58557462 789  
join(58556032..58556232,58556674..58557462)


exon

Literature and cross-references EgrPrx61 (Eucgr.B03369 / Egrandis_v1_0.019151m)
DNA ref. Phytozome 12:   scaffold_2 (58556032..58557462)
Protein sequence: EgrPrx61 (Eucgr.B03369 / Egrandis_v1_0.019151m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   330 (310)
PWM (Da):   %s   36509.38 (34203.1)  
PI (pH):   %s   7.98 (7.97) Peptide Signal:   %s   cut: 20 range:20-329
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTPFHLLLLFLVFFNIATSSESKLTLDYYKKTCPGLQQTIRQVITDKQIASSTTAAATLRLFFHDCMVNGCDGSILISSNAFNTAERDADINLSLPGDGFEVVTRAKTALELECPDIVSCADILALAARDLVTMVGGPYYDVRLGRKDGFVSKASEAEAAMPKPTMPLSQIIKIFEARGLSVQEMVALTGAHTIGFTHCKEFSHRLYNFSKKSDYDPTLYPKYAEGLRKLCENYTKDPTMSAFNDVMTPNKFDNMYYKNLQKGLGLLASDQAMAVDGRTKPYVDLYAGNQTAFFQAFARAIEKVSVYQVKTGRKGEVRHRCDAFNSLQT*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction from phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACGCCCTTTCACCTCCTCCTCCTCTTCCTTGTCTTCTTCAACATCGCAACCTCCTCGGAATCGAAGCTCACCCTCGACTACTACAAGAAGACATGCCCCGGCCTCCAACAAACCATC
CGACAAGTCATCACCGACAAGCAGATCGCCTCCTCCACCACCGCGGCCGCCACCCTCCGCCTCTTCTTCCATGATTGCATG
GTAATTGTAGTGAATGAATGTCCCATTATGTTTTAGGTA
CACAAATTCTAATTTGCGAAATCCGTGTTGACGAGTGTATATCGGTTCGACTGCGGTAGTATCATGTCGGGCTACGTGTTAAGGTTTTCCAAGCCTTCCCGTCCAATTTAGATTCATCTT
GATTGAGGGACTAGATTGATGCTTTGCCAACGTAACGATGCATGGAGAAAAGGATCTCGACAGCATTATGCACAAAATGCAACTATCAATACGTCGCGGGAAATTTGTACTAAATACAAA
ATAAGGGATCTTGAAAAATATTAGGATGTCTTTCTGTAGAATACGAGACTCGATCTGCAAGTTATTGATGTATCGATGAGAAGTATTTTGATTTGGAGTTAGCCCTAACGGTGTTTATAT
TCGATTGGTATTGAACTATGATGAAACTGAATATCCCAACAGGTAAACGGTTGCGACGGCTCCATCCTCATCTCCTCCAACGCGTTCAACACTGCTGAACGCGATGCCGACATCAACCTC
TCCCTCCCCGGCGATGGTTTCGAAGTCGTCACCCGTGCCAAAACCGCTCTCGAGCTCGAATGCCCCGACATTGTGTCGTGTGCGGATATCCTCGCCCTCGCTGCCCGCGACCTCGTGACC
ATGGTCGGTGGCCCCTACTACGACGTCCGCTTGGGCCGAAAGGACGGCTTCGTCTCGAAAGCATCCGAAGCCGAGGCTGCCATGCCGAAGCCGACCATGCCCCTGAGTCAGATCATCAAA
ATCTTCGAGGCGCGAGGGCTCAGCGTGCAAGAGATGGTAGCTCTGACCGGGGCGCACACGATCGGCTTCACGCACTGCAAGGAGTTCAGCCACAGGCTGTACAATTTCAGCAAGAAATCG
GACTACGACCCAACGCTCTACCCCAAGTACGCGGAAGGGCTGAGGAAGCTCTGCGAGAACTACACCAAGGACCCCACGATGTCGGCGTTCAACGACGTGATGACGCCGAACAAGTTCGAC
AACATGTACTACAAGAACCTCCAGAAAGGACTGGGGCTGCTGGCCTCAGACCAGGCGATGGCGGTGGACGGGAGGACGAAGCCGTACGTGGACCTGTATGCGGGGAACCAGACGGCCTTC
TTCCAGGCGTTCGCCCGAGCCATCGAGAAGGTGAGCGTGTATCAGGTGAAGACGGGGAGGAAGGGAGAGGTGAGGCACAGGTGCGACGCCTTCAACTCCCTCCAGACTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACGCCCTTTCACCTCCTCCTCCTCTTCCTTGTCTTCTTCAACATCGCAACCTCCTCGGAATCGAAGCTCACCCTCGACTACTACAAGAAGACATGCCCCGGCCTCCAACAAACCATC
CGACAAGTCATCACCGACAAGCAGATCGCCTCCTCCACCACCGCGGCCGCCACCCTCCGCCTCTTCTTCCATGATTGCATG
GTAAACGGTTGCGACGGCTCCATCCTCATCTCCTCCAAC
GCGTTCAACACTGCTGAACGCGATGCCGACATCAACCTCTCCCTCCCCGGCGATGGTTTCGAAGTCGTCACCCGTGCCAAAACCGCTCTCGAGCTCGAATGCCCCGACATTGTGTCGTGT
GCGGATATCCTCGCCCTCGCTGCCCGCGACCTCGTGACCATGGTCGGTGGCCCCTACTACGACGTCCGCTTGGGCCGAAAGGACGGCTTCGTCTCGAAAGCATCCGAAGCCGAGGCTGCC
ATGCCGAAGCCGACCATGCCCCTGAGTCAGATCATCAAAATCTTCGAGGCGCGAGGGCTCAGCGTGCAAGAGATGGTAGCTCTGACCGGGGCGCACACGATCGGCTTCACGCACTGCAAG
GAGTTCAGCCACAGGCTGTACAATTTCAGCAAGAAATCGGACTACGACCCAACGCTCTACCCCAAGTACGCGGAAGGGCTGAGGAAGCTCTGCGAGAACTACACCAAGGACCCCACGATG
TCGGCGTTCAACGACGTGATGACGCCGAACAAGTTCGACAACATGTACTACAAGAACCTCCAGAAAGGACTGGGGCTGCTGGCCTCAGACCAGGCGATGGCGGTGGACGGGAGGACGAAG
CCGTACGTGGACCTGTATGCGGGGAACCAGACGGCCTTCTTCCAGGCGTTCGCCCGAGCCATCGAGAAGGTGAGCGTGTATCAGGTGAAGACGGGGAGGAAGGGAGAGGTGAGGCACAGG
TGCGACGCCTTCAACTCCCTCCAGACTTGA

Retrieve as FASTA