Entry information : EgrPrx[P]80
Entry ID 8069
Creation 2011-02-04 (Christophe Dunand)
Last sequence changes 2011-02-25 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Qiang Li
Last annotation changes 2012-02-28 (Qiang Li)
Peroxidase information: EgrPrx[P]80
Name EgrPrx[P]80
Class Class III peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrPrx[P]80
start..stop
S start..stop
EglPrx[P]80 164 4e-55 1..85 1..85
EguPrx[P]80 163 6e-55 1..85 1..85
EcamPrx[P]80 112 6e-34 3..75 91..156
EgrPrx[P]79 112 9e-34 3..85 79..154
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 53789247..53789393 147 N° 2 53789965..53790075 111  
join(53789247..53789393,53789965..53790075)


exon

Literature and cross-references EgrPrx[P]80
DNA ref. Phytozome 12:   scaffold_5 (53789247..53790075)
Protein sequence: EgrPrx[P]80
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   85
PWM (Da):   %s   9377.9  
PI (pH):   %s   9.29
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MWKGCDRSILISSKPGSKELAEKDAIDNKDLRAEGFETIAKTKSFVKNKRYHSHTKCPGVISCVDILTIAAKDFVQPVLPSTYRP*

Retrieve as FASTA  
Remarks Pseudogene from genomic (Only exon 2). No prediction from phytozome. No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTGGAAGGGATGTGACAGGTCGATATTGATATCGAGCAAGCCCGGAAGCAAGGAGCTGGCCGAGAAGGACGCGATTGACAACAAAGATTTGAGGGCGGAGGGATTCGAGACAATCGCG
AAAACCAAGTCCTTCGTGAAAAATAAG
GTGCTGCATGACAACATTTCTCATTCTCATAATTTTTGTTCTTTGGTTCCTCTGGAACAAAAAAAGAACAAAAACCCGTTTGGTAACGCCAAG
TTGTTTTTCTATTCCCTGGAATAGAAAGTTAGCCCGGGAATAGATTTGAAGCAGAAACGATAAGCAAAAAAAAATTGCTTCTGTTCCCGAAATAATTTCTAGAAATAAGCTACTTTTCTT
TTTTCTTTTTCTTTTATTCCTCTCTCTTGCCGCGGCCACCTCCGACCGCTCAGAGCCACCGCCGACCGCTGCCGGTCGCTGCCGCCGCTGGGTCGTCGCCGTCATCGGCCACCGCCACTG
GTCGCCGTCGCCGGGCGACGGCGGCAATCCGTGAGCAAGAATAAAAAATAAATAAATACAAAAGAGAAATTGTTGCGTTACCAAACGCATTTCTATTATTTTTCTATTCTAATAGTAGAA
ATTTTGTGTAGTTACCAAACGGGTTTTTTTACTTATAAATTGTTCCCCAAAATAGAAATAGAAAAGAACTATTTCTGAAAAAAAAAAAAAAAAAAAAAACTCTTCCCCAGCCAAGAAGCG
TTACCATTCACACACAAAATGCCCCGGCGTCATTTCTTGTGTTGACATTCTCACCATCGCTGCCAAAGACTTTGTCCAACCGGTACTTCCATCAACCTATCGTCCTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTGGAAGGGATGTGACAGGTCGATATTGATATCGAGCAAGCCCGGAAGCAAGGAGCTGGCCGAGAAGGACGCGATTGACAACAAAGATTTGAGGGCGGAGGGATTCGAGACAATCGCG
AAAACCAAGTCCTTCGTGAAAAATAAG
CGTTACCATTCACACACAAAATGCCCCGGCGTCATTTCTTGTGTTGACATTCTCACCATCGCTGCCAAAGACTTTGTCCAACCGGTACTTCCA
TCAACCTATCGTCCTTAG

Retrieve as FASTA