Entry information : EgrPrx70 (Eucgr.C02747 / Egrandis_v1_0.019287m)
Entry ID 8081
Creation 2011-02-04 (Christophe Dunand)
Last sequence changes 2011-02-04 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2013-10-30 (Qiang Li)
Peroxidase information: EgrPrx70 (Eucgr.C02747 / Egrandis_v1_0.019287m)
Name (synonym) EgrPrx70 (Eucgr.C02747 / Egrandis_v1_0.019287m)
Class Class III peroxidase    [Orthogroup: Prx006]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrPrx70
start..stop
S start..stop
EguPrx70 619 0 1..327 1..327
EglPrx70 612 0 1..327 1..327
EguPrx69 590 0 1..327 25..351
EgrPrx83 587 0 1..327 1..327
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 52575482..52575706 225 N° 2 52575966..52576151 186 N° 3 52576388..52576553 166 N° 4 52577111..52577517 407
join(52575482..52575706,52575966..52576151,52576388..52576553,52577111..52577517 )


exon

Literature and cross-references EgrPrx70 (Eucgr.C02747 / Egrandis_v1_0.019287m)
DNA ref. Phytozome 12:   scaffold_3 (52575482..52577517)
Protein sequence: EgrPrx70 (Eucgr.C02747 / Egrandis_v1_0.019287m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   328 (300)
PWM (Da):   %s   35598.4 (32506.8)  
PI (pH):   %s   8.54 (8.71) Peptide Signal:   %s   cut: 28 range:28-327
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MACPKLFLSCLLLQLMFLFLVPEAAQGQGLKVGFYRKACPNAEIIVKEVIGQVMSVAPSLSGPLLRLHFHDCFVRGCEGSVLLNSPTYQAEKDAHPNHSLRGFQTIDRVKTALEKACPGIVSCADILALVARDVVVATGGLFYYVETGRKDGNVSTSKEALNDLIPSKANITTLKIDFAKRGLSVKDLVVLSGGHTIGTSHCPSFSNRLYNFTGKGDTDPTLDSNYLARLKLSCKPDDQTTLVEMDPGSVRTFDIKYFNLIAKRRGLFTSDAALLDDSQTKAYLDFQIKTGGSTFFKDFGESMVKMGRIGVLTETAGEVRKVCSKVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction from phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTGTCCAAAGCTCTTCTTGTCTTGTTTGTTGCTTCAGTTGATGTTCTTGTTTCTTGTCCCTGAGGCTGCTCAAGGTCAGGGTCTCAAAGTAGGGTTTTACCGGAAGGCATGCCCA
AACGCAGAGATCATCGTGAAGGAAGTCATTGGCCAAGTCATGTCCGTTGCTCCGAGTCTCTCTGGCCCTCTTTTGAGGCTGCATTTTCACGATTGTTTCGTTAGG
GTAAGTAAGAGAGCA
AGCTCCCATGCTCCTCTTCCTACTACGCGTTTGCAGTTTACCAGTTTCTTATGATTTGACCATTTGCATGTAACTAATGTTGGGAACCTAAGATGAGTAGTAATTGGCAAAAGAAGGGAG
GGTGAGAAGTTAGATCCTGGCTTTTATCTGAAGAGGTAATACATGGCAGGGATGCATCGTTACGAACTGTTATCTTCATGAACTCACGGTTGAATATAATGCTTTATTCTGGGCTTTTCC
ACAGGGTTGTGAAGGTTCGGTCTTATTGAACTCTCCGACCTATCAAGCCGAGAAGGACGCCCATCCGAATCACAGCCTTCGAGGTTTCCAAACGATCGATAGAGTCAAAACGGCATTGGA
GAAGGCATGCCCTGGCATCGTTTCGTGTGCTGACATCTTGGCCCTTGTCGCTAGAGACGTTGTCGTCGCG
GTGCGCGCATATTCATACGTCACCGCCTCTATATTTTTTTCTCAAATTTG
AATCTTTGATACATAAGTACGACGTTAGTAGAATTCTCAATTTTCGCAAACGATCTGTCTTATCTCCTTGGAAAACAAATTGTAGCCGCACTAATCTTAGAGGATAAGCACCGACAATTT
TTATTAATGAGAAACACATTTTTATATAGAAATTGGGTTTTTTGTTTTTTTGTGTTGTTGCTTTAGACTGGAGGACTTTTCTATTATGTGGAAACCGGACGTAAAGATGGGAACGTTTCT
ACTTCGAAGGAGGCGCTTAATGATTTAATACCATCTAAAGCCAACATTACAACTCTGAAAATAGATTTTGCAAAGAGAGGCCTCAGTGTGAAGGATCTTGTCGTCCTATCAG
GTAACACC
TAATCTCTAATTATTGTTTCACATTGGTCCTATCAGGTAACACCTAATCTCTAATTATTGCTTCACATTCTTTGTCAAATATTTTGGGGAAATTTTTGAAAAGATGTGCCTATTTCCATA
CTTTGCTTAGGTCAAAGTAACTCTAATTTGTCGAGACAGACTCATGGCTTGCACAGCACAAGTCAAGCTTAGCTGCCTTCCCTTTCATTTTTCGGATGGTCAGTAATTTTCCATGCACTC
AGACTGAACGAAACAAAGTGACTTAGACAATTTTATTTTATTTTCGATAACCTCTGACCAATCTGAGCCGGGCCTTTGCGATATCTAAACCCACGGATGAAAGCTCAAGTGCTGGAAGGT
ATTCCTTCGATCGTGGTACGATCTCTAATGGGGAAAGCTCCCTCACCATGTATAAAAATAGATAAGACATAAATTAATAAGGGAAAAAACTGTTATTTGAGCGAGGGATACATAAACACA
TCACCTGTACAGAGAGAAAACGTAATTTGTAACTGTAGATCATGCTAATTTTGATCTGCTATTAACCAGGTGGGCACACAATTGGAACATCACACTGCCCTTCCTTCTCCAACCGCCTCT
ACAACTTCACCGGAAAGGGCGACACCGACCCCACGCTCGACTCCAACTACTTAGCCAGACTGAAGCTCAGTTGCAAGCCGGATGACCAAACCACTCTCGTCGAGATGGACCCGGGAAGCG
TGAGGACGTTCGACATCAAGTACTTCAATCTCATTGCGAAGAGAAGGGGCCTCTTTACTTCGGACGCCGCACTTCTTGACGACAGCCAAACGAAGGCGTACCTTGACTTCCAGATCAAGA
CCGGTGGATCCACTTTCTTCAAGGACTTTGGAGAGTCGATGGTGAAAATGGGTCGGATTGGCGTGCTGACCGAAACGGCTGGTGAAGTCAGGAAAGTGTGTTCAAAGGTTAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTGTCCAAAGCTCTTCTTGTCTTGTTTGTTGCTTCAGTTGATGTTCTTGTTTCTTGTCCCTGAGGCTGCTCAAGGTCAGGGTCTCAAAGTAGGGTTTTACCGGAAGGCATGCCCA
AACGCAGAGATCATCGTGAAGGAAGTCATTGGCCAAGTCATGTCCGTTGCTCCGAGTCTCTCTGGCCCTCTTTTGAGGCTGCATTTTCACGATTGTTTCGTTAGG
GGTTGTGAAGGTTCG
GTCTTATTGAACTCTCCGACCTATCAAGCCGAGAAGGACGCCCATCCGAATCACAGCCTTCGAGGTTTCCAAACGATCGATAGAGTCAAAACGGCATTGGAGAAGGCATGCCCTGGCATC
GTTTCGTGTGCTGACATCTTGGCCCTTGTCGCTAGAGACGTTGTCGTCGCG
ACTGGAGGACTTTTCTATTATGTGGAAACCGGACGTAAAGATGGGAACGTTTCTACTTCGAAGGAGGCG
CTTAATGATTTAATACCATCTAAAGCCAACATTACAACTCTGAAAATAGATTTTGCAAAGAGAGGCCTCAGTGTGAAGGATCTTGTCGTCCTATCAG
GTGGGCACACAATTGGAACATCA
CACTGCCCTTCCTTCTCCAACCGCCTCTACAACTTCACCGGAAAGGGCGACACCGACCCCACGCTCGACTCCAACTACTTAGCCAGACTGAAGCTCAGTTGCAAGCCGGATGACCAAACC
ACTCTCGTCGAGATGGACCCGGGAAGCGTGAGGACGTTCGACATCAAGTACTTCAATCTCATTGCGAAGAGAAGGGGCCTCTTTACTTCGGACGCCGCACTTCTTGACGACAGCCAAACG
AAGGCGTACCTTGACTTCCAGATCAAGACCGGTGGATCCACTTTCTTCAAGGACTTTGGAGAGTCGATGGTGAAAATGGGTCGGATTGGCGTGCTGACCGAAACGGCTGGTGAAGTCAGG
AAAGTGTGTTCAAAGGTTAATTAA

Retrieve as FASTA