Entry information : EgrPrx53 (Eucgr.A02459 / Egrandis_v1_0.018850m)
Entry ID 8097
Creation 2011-02-04 (Christophe Dunand)
Last sequence changes 2011-02-07 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2013-10-30 (Qiang Li)
Peroxidase information: EgrPrx53 (Eucgr.A02459 / Egrandis_v1_0.018850m)
Name (synonym) EgrPrx53 (Eucgr.A02459 / Egrandis_v1_0.018850m)
Class Class III peroxidase    [Orthogroup: Prx071]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrPrx53
start..stop
S start..stop
EguPrx54 686 0 1..334 1..334
EguPrx53 686 0 1..334 1..334
EglPrx53 686 0 1..334 1..334
EgrPrx54 677 0 1..335 1..335
Gene structure Fichier Exons


exon

Literature and cross-references EgrPrx53 (Eucgr.A02459 / Egrandis_v1_0.018850m)
DNA ref. Phytozome 12:   scaffold_1 (35254045..35256763)
Protein sequence: EgrPrx53 (Eucgr.A02459 / Egrandis_v1_0.018850m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   334 (305)
PWM (Da):   %s   36135.12 (33055.4) Transmb domain:   %s   i7-29o
PI (pH):   %s   6.61 (5.93) Peptide Signal:   %s   cut: 30 range:30-334
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MARSSTLSSPTVVALFAAALLFLLHPLNAELTADFYAKTCPDVSSIVQTVIHEALQYDPRITASLLRLHFHDCFVQGCDGSVLLDNSPTIKSEKDAAPNFNSARGFGVVDKIKAAIESTC
PETVSCADILALAANASVYLSGGPYWTVLLGRRDSLTANQGLANTSIPSPFESYANLTSKFYVLGLDITDLVTLSGAHTFGRAHCKSFTPRLYNFTKNGGPDPTLSPWYLTALQKLCPPN
FNPKVITDLDPTTPNLFDNHYYSNLQKNDGLFETDQELYSTAGAATVPIVNSFSADQSAFFKSFTRSIVNMGNISPLTGSNGEIRCNCRKVNKS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (scaffold_1: 35254008 - 35256987, Egrandis_v1_0.018850m), It very similar to EgraPrx107 (scaffold_1:35,263,534..35,266,207, Egrandis_v1_0.018837m). Correct prediction from phytozome.
DNA
Send to BLAST
CDS
Send to BLAST