1. Browse the Database
  2. View Redoxidase
Entry information : EgrPrx44 ( Eucgr.A01166 / Egrandis_v1_0.017698m)
Entry ID 8098
Creation 2011-02-04 (Christophe Dunand)
Last sequence changes 2016-01-13 (Achraf Jemmat)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-01-14 (Christophe Dunand)
Peroxidase information: EgrPrx44 ( Eucgr.A01166 / Egrandis_v1_0.017698m)
Name (synonym) EgrPrx44 ( Eucgr.A01166 / Egrandis_v1_0.017698m)
Class Class III peroxidase    [Orthogroup: Prx019]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrPrx44
start..stop		 S start..stop
EglPrx44 690 0 1..333 1..333
EcamPrx44 671 0 1..333 1..329
EguPrx44 630 0 27..333 1..307
PtPrx08 511 0 28..332 28..330
Gene structure Fichier Exons►


exon

Literature and cross-references EgrPrx44 ( Eucgr.A01166 / Egrandis_v1_0.017698m)
DNA ref. GenBank:   NW_010092438.1 (18125912..18128534) Phytozome 12:   scaffold_1 (18126933..18128534)
EST ref. GenBank:   HS062700.1 [Fragment]
Protein sequence: EgrPrx44 ( Eucgr.A01166 / Egrandis_v1_0.017698m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   333 (303)
PWM (Da):   %s   36946.2 (33681.5) Transmb domain:   %s   i7-26o
PI (pH):   %s   5.25 (5.00) Peptide Signal:   %s   cut: 31 range:31-333
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATGSFRHYGLGFVLLSLLLQLLSVTCTGSSELQSNYYAESCPNAEEIIKQEVAKLYDEHGNTAISWIRNLFHDCMVQSCDASLLLESKHGNGIVSEQASSRSFGMRNFKYVTKIKEALE
KECPATVSCADIIALSARDGTVLLGGPRIEMRSGRRDGRESHASVVEEFIPNHNDSMALVLSRFESVGIDAEGTVALLGAHSVGRVHCVNLYDRLYPTVDPTLDSDYAEYLKGRCPMPDP
NPEKVRYSRNDRETPMVLDNMYYKHLLAHKGLLLVDQQLASDPTTAPFVEKMAADNGYFQDQFARAMLALSENNPLTGDEGEIRKDCRYINAV*

Retrieve as FASTA  
Remarks Partial sequence from genomic (3 introns +5'). 1 EST.
DNA ►
Send to BLAST
CDS►
Send to BLAST