Entry information : EgrPrx12 (Eucgr.A00298 / Egrandis_v1_0.051618m)
Entry ID 8102
Creation 2011-02-04 (Christophe Dunand)
Last sequence changes 2011-02-07 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2013-10-30 (Qiang Li)
Peroxidase information: EgrPrx12 (Eucgr.A00298 / Egrandis_v1_0.051618m)
Name (synonym) EgrPrx12 (Eucgr.A00298 / Egrandis_v1_0.051618m)
Class Class III peroxidase    [Orthogroup: Prx056]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrPrx12
start..stop
S start..stop
EguPrx12 689 0 1..334 1..334
EgrPrx05 682 0 1..334 1..334
EcamPrx12 677 0 5..334 1..330
EglPrx12 646 0 1..334 1..334
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3808975..3809220 246 N° 2 3809389..3809574 186 N° 3 3809735..3809894 160 N° 4 3810171..3810583 413
join(3808975..3809220,3809389..3809574,3809735..3809894,3810171..3810583)


exon

Literature and cross-references EgrPrx12 (Eucgr.A00298 / Egrandis_v1_0.051618m)
DNA ref. Phytozome 12:   scaffold_1 (3808975..3810583)
Protein sequence: EgrPrx12 (Eucgr.A00298 / Egrandis_v1_0.051618m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   335
PWM (Da):   %s   36994.64  
PI (pH):   %s   6.73
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRASMWWQLLLSMLALVSSCAARRIQAEATIELPPPLQWQFYQNSCPDAEKYVRDQVEFYWKQDRTLAPKLIRIVYSDCFVKGCDASVLLDGPDSEKKAPQNAAFLGFTLEVIDKIKEVLEQHCPGVVSCADIINLAARDAVVLAGGTSYPVPTGRRDGNSSTAKSVDLPLQAVSWGSVVPYFQEKGLDVQDLTTLLGGHSLGKTGCQFVADRLYNFNKTGKPDPSVDPSFLSQLREQCPPNSTNQVYLNPDSGSSYSLGKTFYSRVLNHRAVLGIDQQIAANNDSYQIAQRYDASFEDFKEMFGRSMTRLGLVKLLPGDQGEVRKNCRVVNAK*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Containing motif 'YSDC'. Correct prediction from phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGAGCATCAATGTGGTGGCAGCTTTTGCTATCCATGCTCGCCTTGGTGAGCTCATGCGCGGCACGGCGCATCCAGGCAGAGGCGACTATCGAGCTGCCGCCACCACTGCAGTGGCAG
TTCTACCAGAACTCGTGCCCCGATGCCGAGAAGTATGTGAGGGACCAGGTCGAGTTCTACTGGAAGCAGGACAGGACCCTCGCTCCCAAGCTCATCCGAATTGTCTACTCCGACTGCTTC
GTCAAG
GTCCGTACTGTCTGTTTCTTTTCCCCCCGCTCTCGAACGATCTTGAAGTTTGCATTGCTTCGATATCGAGTTTCCATTGCCTTTCTAAGCACGTGATATCCTTTCACCTAACGT
TTAAACCTCTCGAACCGGGCTTTCTAATGTACCACGCTTTTGTGTATGAAACAGGGGTGCGATGCGTCGGTTCTATTGGACGGGCCAGATTCAGAGAAAAAAGCACCGCAAAATGCAGCG
TTTCTAGGGTTTACGTTGGAGGTGATTGACAAGATCAAGGAAGTCCTGGAGCAGCATTGTCCCGGGGTTGTCTCTTGTGCCGACATTATCAACCTCGCTGCTAGAGATGCTGTTGTCTTG
GTATGCAACATGATTCGCAGCTTTTCCTTTTTGAGCTTGAAAAGAGATCGTTTGGTCTGCACTGCTGATAATCACTATGCTGTTAGCTTGAGTTTTTGGAGCGTTGGATATGGCAAAAGA
AAAAAACAGAATTACTGATGCGATAATGATGTTGTAATAGGCGGGAGGGACGTCGTACCCCGTTCCGACCGGGAGGAGGGACGGGAATTCATCCACTGCAAAGTCAGTGGACTTACCGTT
GCAAGCCGTCTCGTGGGGATCGGTGGTCCCTTACTTCCAAGAAAAGGGCTTGGATGTGCAGGACCTCACCACTCTACTTG
GTACGATCCGAACCTCCCATAAAAACTGCTTATTTGGCTC
CGTTACATTACCTTGAGATCGTAACCAATCCAGGCAAATCGTTCAGTTCAATGAACCATGACGTCCCTTTTCGCTTTCGAGTTTTCTAAATCACTGCCTAGGTGTCATGATACAAAGAAT
TCTTCTGACAGTGATCTCCTCCAAGTGCACAAAATGGCATTGCTCACGTATTATGTTAATCTCTCGATCATAACGAATTCCTCCTAACTTTGCCAAAACAATTTAAATTTTGACAGGGGG
GCATTCACTGGGCAAGACCGGCTGCCAATTCGTCGCGGACAGGCTGTACAATTTCAACAAGACCGGCAAGCCAGACCCAAGCGTGGACCCATCCTTTTTGTCCCAATTGAGGGAGCAATG
CCCACCAAACTCAACGAACCAAGTGTACCTTAACCCTGACTCAGGCTCGAGCTACAGCTTGGGCAAGACCTTCTACTCCAGGGTCCTGAACCACCGGGCCGTCCTAGGCATCGACCAGCA
GATTGCCGCCAACAACGACAGCTACCAGATCGCTCAGAGGTACGATGCCAGTTTCGAGGACTTCAAGGAGATGTTCGGCCGGTCAATGACCCGGCTGGGGCTCGTCAAGCTCCTTCCGGG
GGATCAGGGGGAGGTTCGCAAGAATTGCCGAGTCGTGAATGCGAAATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGAGCATCAATGTGGTGGCAGCTTTTGCTATCCATGCTCGCCTTGGTGAGCTCATGCGCGGCACGGCGCATCCAGGCAGAGGCGACTATCGAGCTGCCGCCACCACTGCAGTGGCAG
TTCTACCAGAACTCGTGCCCCGATGCCGAGAAGTATGTGAGGGACCAGGTCGAGTTCTACTGGAAGCAGGACAGGACCCTCGCTCCCAAGCTCATCCGAATTGTCTACTCCGACTGCTTC
GTCAAG
GGGTGCGATGCGTCGGTTCTATTGGACGGGCCAGATTCAGAGAAAAAAGCACCGCAAAATGCAGCGTTTCTAGGGTTTACGTTGGAGGTGATTGACAAGATCAAGGAAGTCCTG
GAGCAGCATTGTCCCGGGGTTGTCTCTTGTGCCGACATTATCAACCTCGCTGCTAGAGATGCTGTTGTCTTG
GCGGGAGGGACGTCGTACCCCGTTCCGACCGGGAGGAGGGACGGGAAT
TCATCCACTGCAAAGTCAGTGGACTTACCGTTGCAAGCCGTCTCGTGGGGATCGGTGGTCCCTTACTTCCAAGAAAAGGGCTTGGATGTGCAGGACCTCACCACTCTACTTG
GGGGGCAT
TCACTGGGCAAGACCGGCTGCCAATTCGTCGCGGACAGGCTGTACAATTTCAACAAGACCGGCAAGCCAGACCCAAGCGTGGACCCATCCTTTTTGTCCCAATTGAGGGAGCAATGCCCA
CCAAACTCAACGAACCAAGTGTACCTTAACCCTGACTCAGGCTCGAGCTACAGCTTGGGCAAGACCTTCTACTCCAGGGTCCTGAACCACCGGGCCGTCCTAGGCATCGACCAGCAGATT
GCCGCCAACAACGACAGCTACCAGATCGCTCAGAGGTACGATGCCAGTTTCGAGGACTTCAAGGAGATGTTCGGCCGGTCAATGACCCGGCTGGGGCTCGTCAAGCTCCTTCCGGGGGAT
CAGGGGGAGGTTCGCAAGAATTGCCGAGTCGTGAATGCGAAATAA

Retrieve as FASTA