Entry information : EgrPrx05(Eucgr.A00043 / Egrandis_v1_0.043198m)
Entry ID 8105
Creation 2011-02-04 (Christophe Dunand)
Last sequence changes 2016-03-21 (Catherine )
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2022-03-28 (Catherine )
Peroxidase information: EgrPrx05(Eucgr.A00043 / Egrandis_v1_0.043198m)
Name EgrPrx05(Eucgr.A00043 / Egrandis_v1_0.043198m)
Class Class III peroxidase    [Orthogroup: Prx063]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrPrx05
start..stop
S start..stop
EgrPrx12 682 0 1..334 1..334
EguPrx12 681 0 1..334 1..334
EcamPrx12 669 0 5..334 1..330
EglPrx12 636 0 1..334 1..334
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 423579..423824 246 N° 2 423225..423410 186 N° 3 422904..423063 160 N° 4 422215..422627 413
complement(join(422215..422627,422904..423063,423225..423410,423579..423824))


exon

Literature and cross-references EgrPrx05(Eucgr.A00043 / Egrandis_v1_0.043198m)
DNA ref. Phytozome 12:   scaffold_1 (423824..422215)
Cluster/Prediction ref. Genebank:   104450810
Protein sequence: EgrPrx05(Eucgr.A00043 / Egrandis_v1_0.043198m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   334 (312)
PWM (Da):   %s   37022.72 (34415.4)  
PI (pH):   %s   7.91 (7.67) Peptide Signal:   %s   cut: 23 range:23-334
Sequence 376
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRASMWWQLLLSMLTLVSSCAARRIQGEATIELPPPLQWQFYQNSCPDAEKYVRDQVEFYWKQDRTLAPKLIRIVYSDCFVKGCDASVLLDGPDSEKTAPQNAAFLGFTLEVIDKIKEVLEQHCPGVVSCADIINLAARDAVVLAGGTSYPVPTGRRDGNSSTAKSVDLPLQAVSWGSVVPYFQEKGLDVQDLTTLLGGHSLGKTGCQFIADRLYNFNKTGKPDPSVDPSFLSQLREQCPPNSTNQVYLNPDSGSSYNLGKTFYSRVLNHRAVLGIDQQIAANNDSYQIAQRYDASFKDFKKMFGRSMTRLGLVKLLPGDQGEVRKNCRVVNAK*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). Incorrect prediction from Phytozome (A short sequence in frame is missing). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGAGCATCAATGTGGTGGCAGCTTTTGCTATCCATGCTCACCTTGGTGAGCTCATGCGCGGCACGGCGCATCCAGGGAGAGGCGACGATCGAGCTGCCGCCACCACTGCAGTGGCAG
TTCTACCAGAACTCGTGCCCCGATGCCGAGAAGTATGTGAGGGACCAGGTCGAGTTCTACTGGAAGCAGGACAGGACCCTCGCTCCCAAGCTCATCCGAATTGTCTACTCCGACTGCTTC
GTCAAG
GTCCGTACTGTCTGTTTCTTTTCCCCCCGCTCTCGAACGATCTTGAAGTTTGCATCGCTTCGATATCGAGCTTCCATTGCCTTTCTAAGCACGTGATATCCTTTCACCTAACGT
TTAAACCTCTCGAACCGGGCTTTCTAATGTACCGCGCTTTTGTGTATGAAACAGGGGTGCGATGCGTCGGTTCTATTGGACGGGCCAGATTCAGAGAAAACAGCACCACAAAATGCAGCG
TTTCTAGGGTTTACGTTGGAGGTGATTGACAAGATCAAGGAAGTCCTGGAGCAGCATTGTCCCGGGGTTGTCTCTTGTGCCGACATTATCAACCTCGCTGCTAGAGATGCTGTTGTCTTG
GTATGCAACATGATTCGCAGTTTTCCTTTTTGAGCTTGAAAAGAGATCGTTTGGTCTGCACTGATGATAATCACTATGCTGTTAGCTTGAGTTTTTGGAGCGTTCGATATGGCAAAAGAA
AAAAAAACAGAATTACTGATGCGATAATGATGTTGTAATAGGCGGGAGGGACGTCGTACCCCGTTCCGACCGGGAGGAGGGACGGGAATTCATCCACTGCAAAGTCAGTGGACTTACCGT
TGCAAGCCGTCTCGTGGGGATCGGTGGTCCCTTACTTCCAAGAAAAGGGCTTGGATGTGCAGGACCTCACCACTCTACTTG
GTACGATCCGAACCTCCCATGAAAACTGCTTATTTGGCT
CCGTTACATTACCTTGAGATCGTAACCAATCCAGGCAAATCGTTCAGTTCAATGAATCATGACGTCCCTCTTCGCTTTCGAGTTTTCTAAATCGCTGCCTAGGTGTCATGATACAAAGAA
TTCTTCTGACAATGATCTCCTCCAAGTGCACAAAACGGCATTGCTCACGTATTATGTTAATCTCTCGATCATAACCAATTCCTCCTAACTTTGCCAAAACAATTTAAATTTTGACAGGGG
GGCATTCACTGGGCAAGACCGGCTGCCAGTTCATCGCGGACAGGCTGTACAATTTCAACAAGACCGGCAAGCCAGACCCAAGCGTGGACCCATCCTTTTTGTCCCAATTGAGGGAGCAAT
GCCCACCAAACTCAACGAACCAAGTGTACCTTAACCCTGACTCAGGCTCGAGCTACAACTTGGGCAAGACCTTCTACTCCAGGGTCCTGAACCACCGGGCCGTCCTAGGCATCGACCAGC
AAATTGCCGCCAACAACGACAGCTACCAGATCGCTCAGAGGTACGATGCCAGTTTCAAGGACTTCAAGAAGATGTTCGGCCGGTCAATGACCCGGCTAGGGCTCGTCAAGCTCCTTCCGG
GGGATCAGGGGGAGGTTCGCAAGAATTGCCGAGTCGTGAATGCGAAATA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGAGCATCAATGTGGTGGCAGCTTTTGCTATCCATGCTCACCTTGGTGAGCTCATGCGCGGCACGGCGCATCCAGGGAGAGGCGACGATCGAGCTGCCGCCACCACTGCAGTGGCAG
TTCTACCAGAACTCGTGCCCCGATGCCGAGAAGTATGTGAGGGACCAGGTCGAGTTCTACTGGAAGCAGGACAGGACCCTCGCTCCCAAGCTCATCCGAATTGTCTACTCCGACTGCTTC
GTCAAG
GGGTGCGATGCGTCGGTTCTATTGGACGGGCCAGATTCAGAGAAAACAGCACCACAAAATGCAGCGTTTCTAGGGTTTACGTTGGAGGTGATTGACAAGATCAAGGAAGTCCTG
GAGCAGCATTGTCCCGGGGTTGTCTCTTGTGCCGACATTATCAACCTCGCTGCTAGAGATGCTGTTGTCTTG
GCGGGAGGGACGTCGTACCCCGTTCCGACCGGGAGGAGGGACGGGAAT
TCATCCACTGCAAAGTCAGTGGACTTACCGTTGCAAGCCGTCTCGTGGGGATCGGTGGTCCCTTACTTCCAAGAAAAGGGCTTGGATGTGCAGGACCTCACCACTCTACTTG
GGGGGCAT
TCACTGGGCAAGACCGGCTGCCAGTTCATCGCGGACAGGCTGTACAATTTCAACAAGACCGGCAAGCCAGACCCAAGCGTGGACCCATCCTTTTTGTCCCAATTGAGGGAGCAATGCCCA
CCAAACTCAACGAACCAAGTGTACCTTAACCCTGACTCAGGCTCGAGCTACAACTTGGGCAAGACCTTCTACTCCAGGGTCCTGAACCACCGGGCCGTCCTAGGCATCGACCAGCAAATT
GCCGCCAACAACGACAGCTACCAGATCGCTCAGAGGTACGATGCCAGTTTCAAGGACTTCAAGAAGATGTTCGGCCGGTCAATGACCCGGCTAGGGCTCGTCAAGCTCCTTCCGGGGGAT
CAGGGGGAGGTTCGCAAGAATTGCCGAGTCGTGAATGCGAAATA

Retrieve as FASTA