Entry information : EgrPrx16 (Eucgr.A00301 / Egrandis_v1_0.018615m)
Entry ID 8106
Creation 2011-02-04 (Christophe Dunand)
Last sequence changes 2011-02-07 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2013-10-30 (Qiang Li)
Peroxidase information: EgrPrx16 (Eucgr.A00301 / Egrandis_v1_0.018615m)
Name (synonym) EgrPrx16 (Eucgr.A00301 / Egrandis_v1_0.018615m)
Class Class III peroxidase    [Orthogroup: Prx029]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrPrx16
start..stop
S start..stop
EglPrx16 697 0 1..337 1..337
EcamPrx01 696 0 1..337 1..337
EcamPrx16 694 0 1..337 1..337
EguPrx01 694 0 1..337 1..337
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3837880..3838122 243 N° 2 3838292..3838477 186 N° 3 3838625..3838784 160 N° 4 3838901..3839325 425
join(3837880..3838122,3838292..3838477,3838625..3838784,3838901..3839325)


exon

Literature and cross-references EgrPrx16 (Eucgr.A00301 / Egrandis_v1_0.018615m)
DNA ref. Phytozome 12:   scaffold_1 (3837880..3839325)
Protein sequence: EgrPrx16 (Eucgr.A00301 / Egrandis_v1_0.018615m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   338
PWM (Da):   %s   37269.46  
PI (pH):   %s   5.91
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSRWGLLLLLSELALVSLCAVQHVEAAEGLEPPLTLKWHYYRNSCRDAETYVRHQVEYYWKPDKSLTPKLLRLLYSDCFITGCDASILLDGQNSEKTAPQNSGLEGYGTVVIDKIKQVLEQRCPGVVSCADILNLAARDAAHLAGAPSYPVLTGRRDGMSSSKASVDLPSPSISWEEALAYFESRNLDVLDLATLLGAHSMGKTHCSYITDRLYNYNSTGKPDPDMDPSYLAQMRKQCPPNSKSQGDPQVFLDPASGSSYTFSNSYYSRLLNHQATLGIDQQLARGDDTSQIAQEYDAGLEDFRKEFALSMARMGNIKVLTGNQGEIRKNCRAVNSK*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Containing motif 'YSDC'. Correct prediction from phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGAGGTGGGGGTTACTGCTGTTGCTGTCGGAGCTTGCGTTGGTGAGCTTGTGCGCGGTGCAGCACGTCGAGGCAGCAGAGGGGCTCGAGCCGCCGCTGACACTGAAGTGGCACTAC
TACCGGAACTCGTGCCGCGATGCTGAGACGTATGTGAGGCACCAGGTCGAGTACTACTGGAAGCCGGACAAGAGCCTCACTCCTAAGCTCCTCCGACTGCTCTACTCTGACTGCTTCATC
ACG
GTACATATCGTCTGTTGTCATCGCTTTCATACCGAGTTTCAGTAGGCTTTCTGAGCTCTCTAACATATAATAATGGTGGAAACCGGGCATGTACGAGCAATAACTTGTTTTTTTCCT
TTAAAAAACAAAGGCTTGTATTGAGATACGTTTGGCTACCTGTGTAAAACAGGGGTGTGATGCGTCTATTCTGTTGGACGGGCAAAATTCAGAGAAAACAGCGCCACAAAATTCAGGGCT
TGAAGGGTATGGTACGGTGGTGATAGACAAGATCAAGCAAGTCCTGGAACAACGTTGTCCTGGAGTTGTGTCTTGTGCTGACATTCTCAACCTTGCTGCCAGAGATGCCGCTCACTTG
GT
ATGTGCCTGGTTTGCAGTTCTCTTCTTTGGCTTCAAAAGAGATTATTTTCACTGCCCTACCGATCATTGAAATGCTGCTAGCTTGAACTTGTAGTATTAGATGTGAAAAACCAGAATCGC
TGACACGATAATGTTTTTCTCACAGGCGGGAGCGCCATCTTACCCCGTCCTGACGGGGAGGAGAGACGGGATGTCGTCGTCCAAGGCGTCGGTGGACCTCCCGTCGCCATCCATCTCGTG
GGAAGAGGCGCTCGCTTACTTCGAATCGAGGAACTTGGATGTGCTAGACCTTGCCACTCTACTTG
GTAAGATGGATCATTGTATAAAAAAGTAAATAATTGATTTGGACCTCATCAAGTC
ATCGCTTTTTGAAACATTAAAATCAATTCCTAACTTTGCGCAAAAATATGAAATTGGACAGGGGCTCATTCAATGGGCAAGACTCACTGCAGCTACATCACAGACAGGCTGTACAATTAC
AACTCCACTGGCAAGCCAGACCCAGATATGGACCCATCCTACCTGGCCCAAATGAGGAAGCAATGCCCACCAAACTCAAAGAGCCAAGGTGACCCTCAGGTGTTCCTTGACCCCGCCTCA
GGCTCCAGCTACACATTCAGCAACTCCTACTACTCCAGGCTCCTGAACCACCAGGCCACCCTTGGCATCGACCAGCAGCTCGCCCGCGGTGACGACACTTCCCAGATCGCTCAGGAGTAT
GATGCTGGGCTGGAGGACTTCCGGAAGGAGTTCGCTCTGTCAATGGCCCGGATGGGGAACATCAAGGTCTTGACGGGGAATCAGGGGGAGATCCGCAAGAATTGCAGAGCCGTGAACAGC
AAATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGAGGTGGGGGTTACTGCTGTTGCTGTCGGAGCTTGCGTTGGTGAGCTTGTGCGCGGTGCAGCACGTCGAGGCAGCAGAGGGGCTCGAGCCGCCGCTGACACTGAAGTGGCACTAC
TACCGGAACTCGTGCCGCGATGCTGAGACGTATGTGAGGCACCAGGTCGAGTACTACTGGAAGCCGGACAAGAGCCTCACTCCTAAGCTCCTCCGACTGCTCTACTCTGACTGCTTCATC
ACG
GGGTGTGATGCGTCTATTCTGTTGGACGGGCAAAATTCAGAGAAAACAGCGCCACAAAATTCAGGGCTTGAAGGGTATGGTACGGTGGTGATAGACAAGATCAAGCAAGTCCTGGAA
CAACGTTGTCCTGGAGTTGTGTCTTGTGCTGACATTCTCAACCTTGCTGCCAGAGATGCCGCTCACTTG
GCGGGAGCGCCATCTTACCCCGTCCTGACGGGGAGGAGAGACGGGATGTCG
TCGTCCAAGGCGTCGGTGGACCTCCCGTCGCCATCCATCTCGTGGGAAGAGGCGCTCGCTTACTTCGAATCGAGGAACTTGGATGTGCTAGACCTTGCCACTCTACTTG
GGGCTCATTCA
ATGGGCAAGACTCACTGCAGCTACATCACAGACAGGCTGTACAATTACAACTCCACTGGCAAGCCAGACCCAGATATGGACCCATCCTACCTGGCCCAAATGAGGAAGCAATGCCCACCA
AACTCAAAGAGCCAAGGTGACCCTCAGGTGTTCCTTGACCCCGCCTCAGGCTCCAGCTACACATTCAGCAACTCCTACTACTCCAGGCTCCTGAACCACCAGGCCACCCTTGGCATCGAC
CAGCAGCTCGCCCGCGGTGACGACACTTCCCAGATCGCTCAGGAGTATGATGCTGGGCTGGAGGACTTCCGGAAGGAGTTCGCTCTGTCAATGGCCCGGATGGGGAACATCAAGGTCTTG
ACGGGGAATCAGGGGGAGATCCGCAAGAATTGCAGAGCCGTGAACAGCAAATAA

Retrieve as FASTA