Entry information : EgrPrx13 (Eucgr.A00299 / Egrandis_v1_0.018809m)
Entry ID 8111
Creation 2011-02-04 (Christophe Dunand)
Last sequence changes 2011-02-07 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2013-10-30 (Qiang Li)
Peroxidase information: EgrPrx13 (Eucgr.A00299 / Egrandis_v1_0.018809m)
Name (synonym) EgrPrx13 (Eucgr.A00299 / Egrandis_v1_0.018809m)
Class Class III peroxidase    [Orthogroup: Prx080]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrPrx13
start..stop
S start..stop
EgrPrx04 687 0 1..335 1..335
EguPrx04 683 0 1..334 1..334
EcamPrx04 676 0 5..334 1..330
EglPrx13 615 0 1..334 1..313
Gene structure Fichier Exons


exon

Literature and cross-references EgrPrx13 (Eucgr.A00299 / Egrandis_v1_0.018809m)
DNA ref. Phytozome 12:   scaffold_1 (3822006..3823636)
Protein sequence: EgrPrx13 (Eucgr.A00299 / Egrandis_v1_0.018809m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   334 (315)
PWM (Da):   %s   37541.91 (35239.7) Transmb domain:   %s   o272-291i351-373o406-428i455-477o
PI (pH):   %s   6.17 (5.64) Peptide Signal:   %s   cut: 20 range:20-334
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRASMWWQLLLSTLALVSSCAVWHVEAEATIELPPPLQWHFYQNSCPDVERYVRDQVEFYWKQDSTLAVKLIQLLYTDCFIKGCDASILLDGPDTEKTAPQNAPILGFPLEAIDKVKEVL
EQHCPGVVSCADIINLAARDAVVLAGGVSYPVPTGRRDGNSSSAKLVDIAVHATPWEKVIHYFEVRGMNVFDVTTLLGGHTLGRTRCKFIAERLYDFNNTGKPDPSMDPSFLAELRVQCP
PNSTNSVYLNPDSGSSNRFGKTFYSRVLNHRAVLSIDQQIADREESLQIARRYDANFEDFLKMFGYAMTKLGNTWLLPGDQGEIRKNCRVVNRK*

Retrieve as FASTA  
Remarks Complete sequence from genomic. ALT transcript: Egrandis_v1_0.023803m (exons, 2, 3 and 4). Containing motif 'YTDC'. Correct prediction from phytozome.
DNA
Send to BLAST
CDS
Send to BLAST