Entry information : EgrPrx158 (Eucgr.J02484 / Egrandis_v1_0.020027m)
Entry ID 8114
Creation 2011-02-04 (Christophe Dunand)
Last sequence changes 2011-02-07 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2013-10-30 (Qiang Li)
Peroxidase information: EgrPrx158 (Eucgr.J02484 / Egrandis_v1_0.020027m)
Name (synonym) EgrPrx158 (Eucgr.J02484 / Egrandis_v1_0.020027m)
Class Class III peroxidase    [Orthogroup: Prx017]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrPrx158
start..stop
S start..stop
EcamPrx158 644 0 1..316 1..316
EglPrx158 644 0 1..316 1..316
EguPrx158 627 0 1..316 1..316
PpePrx30 526 0 1..316 1..318
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 30940397..30940600 204 N° 2 30940108..30940296 189 N° 3 30939426..30939588 163 N° 4 30938898..30939292 395
complement(join(30938898..30939292,30939426..30939588,30940108..30940296,3094039 7..30940600))


exon

Literature and cross-references EgrPrx158 (Eucgr.J02484 / Egrandis_v1_0.020027m)
DNA ref. Phytozome 12:   scaffold_10 (30940600..30938898)
Protein sequence: EgrPrx158 (Eucgr.J02484 / Egrandis_v1_0.020027m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   317 (294)
PWM (Da):   %s   33875.16 (31541.9)  
PI (pH):   %s   8.92 (8.92) Peptide Signal:   %s   cut: 23 range:23-316
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAIGVALFSSLLVLSFVSPISSLSSNYYDKTCPNAELIVANAVKNAAMKDKTVPAALLRMHFHDCFIRGCDASVLLNSKGSNKVEKDGPPNVSLHSFFVIDNTKKELEASCPGVVSCADILALAARDSVVLSGGPTWDVPKGRKDGRTSKASETTQLPAPLFNISQLQQSFSQRGLSMEDLVALSGGHTLGFSHCSSFAGRIRNFNTTHDIDPSMHPSLAASLRGVCPSKNRPKNAGTTMDPSSTTFDNTYYRLILQGKGLFSSDQALLAVPKTKDLVEKFAGSHKEFTDAFVKSMIKMSSITGGGEVRKDCRVVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction from phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCATCGGTGTTGCACTCTTCAGCTCGCTTCTTGTACTTTCATTTGTCTCTCCAATCTCTTCACTAAGTTCCAATTACTACGACAAGACCTGTCCCAATGCTGAGTTGATCGTCGCA
AATGCTGTCAAGAATGCGGCAATGAAGGACAAAACCGTTCCGGCTGCTCTTCTGCGGATGCATTTTCACGACTGTTTCATTAGG
GTAAGCAAACGTGTCTGATAGTTCTCTATCTGTTTC
AGAGTTCTTACACAAAGCTTCCTTAGTTATCAGAACTCAACAGATAGTTCTCTATCTGTTTCAGGGTTGCGATGCGTCGGTGCTTTTAAACTCCAAAGGAAGCAACAAAGTGGAGAAGGA
TGGACCTCCTAATGTCTCTCTGCACTCATTTTTTGTAATCGACAATACCAAAAAGGAGTTGGAAGCTTCTTGCCCCGGCGTGGTTTCATGTGCGGACATCTTGGCACTAGCTGCTAGAGA
TTCCGTCGTACTG
GTAAAATCTCTCCTCATCCACTTCGTTACGTGTATATCCCGATTCTTCACGACCAACCAATCCCTCCAGCATAGCTTGTCACTGAGATTGTCCTGAAAATCCACCCT
AAACCGTCTAAAACATAAACGCTGATGTCTTGGAAACATCTTAGGGCCAAGTGTAGGGATCCTGTCCAATCCTGAGCTTACTGCGCAATGTCCTGGACAGTCTTCACGCAGGTCTCTATC
CTGGAAAATAATAGAGAAACCAGGCAGGACGGTGTTAAGCTACCAACTCTTGGGAATGTCTGCTTGCACCGCAAGAATTTGGATAGATACATATTCACTCAATATGTGCATAAATAGGTT
TAAACAGGACCAAACGGAAGTCGGCCTACTGGAAGCTAAATCAATGCCCACTGAACAAATCCCTTCCCCCAGTAGCAATTTTAGCCGTAATTTCTCCACTAGAAGGTTCCCTTGTGCACA
GCATATTGCGTATCTCACTGAGATTTTCTTTCATTTCTGATGCGTAAAAAAGTCCGGAGGTCCGACTTGGGATGTGCCCAAGGGAAGGAAGGATGGAAGAACATCAAAAGCCAGCGAGAC
GACTCAACTCCCAGCACCACTTTTCAACATTTCTCAGCTCCAGCAGAGCTTCTCCCAGAGAGGCCTCTCTATGGAAGATCTCGTCGCTCTTTCGG
GTATAACAAATAATCAAACGGACCA
ATATATGACGGTGTTTTGTCGAGAAATTCACTCTGCCAGATTCATTCATTTGTTTTGGTTTTTCACCTGTGCTGATTCTGATCTCAACTTCTATCCCTCCCCTTGCAGGAGGCCACACAC
TAGGATTTTCCCACTGCTCCTCCTTCGCAGGCAGGATCCGCAACTTCAACACCACGCACGACATCGACCCATCGATGCACCCATCCCTGGCAGCGAGCCTAAGAGGCGTATGCCCGAGCA
AGAACAGGCCAAAAAACGCAGGGACCACCATGGACCCTTCCTCGACCACCTTCGACAACACGTACTACAGGCTGATCCTCCAGGGGAAGGGCCTGTTCTCTTCGGACCAGGCCCTCCTGG
CAGTGCCCAAGACGAAGGATCTGGTCGAGAAGTTCGCAGGCTCGCACAAGGAATTCACGGATGCATTCGTCAAGTCCATGATCAAGATGAGCAGCATCACAGGCGGAGGGGAAGTTAGGA
AGGACTGCAGGGTAGTCAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCATCGGTGTTGCACTCTTCAGCTCGCTTCTTGTACTTTCATTTGTCTCTCCAATCTCTTCACTAAGTTCCAATTACTACGACAAGACCTGTCCCAATGCTGAGTTGATCGTCGCA
AATGCTGTCAAGAATGCGGCAATGAAGGACAAAACCGTTCCGGCTGCTCTTCTGCGGATGCATTTTCACGACTGTTTCATTAGG
GGTTGCGATGCGTCGGTGCTTTTAAACTCCAAAGGA
AGCAACAAAGTGGAGAAGGATGGACCTCCTAATGTCTCTCTGCACTCATTTTTTGTAATCGACAATACCAAAAAGGAGTTGGAAGCTTCTTGCCCCGGCGTGGTTTCATGTGCGGACATC
TTGGCACTAGCTGCTAGAGATTCCGTCGTACTG
TCCGGAGGTCCGACTTGGGATGTGCCCAAGGGAAGGAAGGATGGAAGAACATCAAAAGCCAGCGAGACGACTCAACTCCCAGCACCA
CTTTTCAACATTTCTCAGCTCCAGCAGAGCTTCTCCCAGAGAGGCCTCTCTATGGAAGATCTCGTCGCTCTTTCGG
GAGGCCACACACTAGGATTTTCCCACTGCTCCTCCTTCGCAGGC
AGGATCCGCAACTTCAACACCACGCACGACATCGACCCATCGATGCACCCATCCCTGGCAGCGAGCCTAAGAGGCGTATGCCCGAGCAAGAACAGGCCAAAAAACGCAGGGACCACCATG
GACCCTTCCTCGACCACCTTCGACAACACGTACTACAGGCTGATCCTCCAGGGGAAGGGCCTGTTCTCTTCGGACCAGGCCCTCCTGGCAGTGCCCAAGACGAAGGATCTGGTCGAGAAG
TTCGCAGGCTCGCACAAGGAATTCACGGATGCATTCGTCAAGTCCATGATCAAGATGAGCAGCATCACAGGCGGAGGGGAAGTTAGGAAGGACTGCAGGGTAGTCAATTAA

Retrieve as FASTA