Entry information : EgrPrx120 (Eucgr.H00889 / Egrandis_v1_0.051123m)
Entry ID 8127
Creation 2011-02-04 (Christophe Dunand)
Last sequence changes 2011-02-08 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-03-07 (Qiang Li)
Peroxidase information: EgrPrx120 (Eucgr.H00889 / Egrandis_v1_0.051123m)
Name (synonym) EgrPrx120 (Eucgr.H00889 / Egrandis_v1_0.051123m)
Class Class III peroxidase    [Orthogroup: Prx218]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrPrx120
start..stop
S start..stop
EglPrx120 692 0 1..335 1..335
EcamPrx120 687 0 1..335 1..335
EguPrx120 643 0 1..335 1..335
EcamPrx119 454 1e-161 5..335 7..338
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 11032761..11033000 240 N° 2 11034237..11035004 768  
join(11032761..11033000,11034237..11035004)


exon

Literature and cross-references EgrPrx120 (Eucgr.H00889 / Egrandis_v1_0.051123m)
DNA ref. Phytozome 12:   scaffold_8 (11032761..11035004)
Protein sequence: EgrPrx120 (Eucgr.H00889 / Egrandis_v1_0.051123m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   336 (314)
PWM (Da):   %s   36439.46 (34200.3) Transmb domain:   %s   i7-29o
PI (pH):   %s   8.98 (8.98) Peptide Signal:   %s   cut: 22 range:22-335
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASIQALVASFFLVFAVSATALPTQVYPLSSPSSLSVGFYKYTCPPAEAIVRATLYEAFSSDPGLAADFLRMYFHDCFVRGCDASILLNSTKGNTAEKDSPVNNPSLEGFDVIDQAKARLEAACPRTVSCADIIAFAARDSVFKAGRIYYDVPSGRRDGRISRASEVIQNLPPPTFTVPQLIANFARKGFSMDEMVTLSGAHSIGSSHCSSFSNRLYSFNATHKQDPLLDPKYAAFLKTKCPQGNSKTDPKVALDSITPNTLDNKYYQQLLTYRGLFSSDEALYTSKLTKGMVLNNAKYGRVWGPKFVKAMVKLGSLDVLTGQQGEIRKVCGAVN*

Retrieve as FASTA  
Remarks Complete sequence fromgenomic. Incorrect prediction from Phytozome. Short 3' end with stop codon is missing. Similar exon 1 also found in Scaffold _79 (Egrandis_v1_0.051906m, surrounded by undetermined nt)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCCATTCAAGCCCTGGTCGCTTCCTTCTTCCTAGTTTTTGCTGTATCTGCAACAGCTCTCCCTACGCAGGTGTACCCGTTGTCTTCGCCATCGTCCCTCAGCGTCGGATTCTAC
AAATATACATGCCCTCCTGCCGAAGCCATCGTCAGAGCCACTCTTTATGAGGCCTTTTCCAGTGATCCGGGGTTGGCTGCTGATTTCCTCCGGATGTATTTCCACGACTGCTTCGTGAGG
GTAATATGCTCTATATGAACATCAAATGAAGGATTTTGCGCTTATTCGTCATTCATTTTCTTGATTTTCCAATAATGTGTTGATGCATACTCAAATATCAGTTAAAATACAAAGTTGCCA
TGTTAACACCGACACCAAGATACTCTAGAAACGATATGGTGCCTTAAATGGGAAAATTATCAAAAAAAGTCTTAAACCTATTGTAATTGTGCCAATTCAGTCTTAATTTTTTTTTCTTTT
GCCAATTCAATCATGACGTGGACAATTTTAATAATATTTTAATTTTTTCGAATTTTTTAATAACTTTTTCTTTTTTCTTTTTCTTTTTCTTTTTCCTCTTCTTCCCCCTTTTCCTTTTTT
CCCCTACAGTGGCCGACGAGGCTCTGGCGAAGGTCACGGCCCTCGCTCGGCCTTGCCTAGGTCTAGACAAGGTCTAGGGGCTATAGGCAAGGCGGCTTTGCCCAAATCTAGGCGAGACCA
ACCTCGCCATGTCCTTCCTAGCCACGGGTGAAGGTGGCCTTGCCCACATCTAGGTGAAGCTGCCTCACCCACAAGCCCCAGGCCTTGGGCTAGGCCGGGAGAGGGCTACGACTTTCACCG
GTGGCCGACAAGTGCTTCACAGCCCTCACCGGAAAAATGAAAAAAAGAGGAAAAATCAAAATCACAAAAAAAATAATAAAATAAAATATTATTCAAAATTGTCCACATCAGCACCTATAA
GCCAAAATTGGATGGATGGACTTCATTGGCACGATTGGAAAATGTTTAGGATTGAATTGGCAAAAAAAAAACAAAAGATTTAAAACTAAATTGGCACAATTATAATAGATTTAATTTAAT
TTAATTTTTTTGTGATTCTCCCTACCCTAAACCTATCACAAGCATACAAGAAATGCATCAAAACATATGTATTTTTAGTGTTGTGTAGTGTAAAATTGCACCTTTCCCTGGTTGCTATTT
CTTACAGTGGAATGGATATAAAGAATGATTTCTCAATGCACATGCCGAGGCAGCAACTTATCACTAAGTTGTGCTTTGGCTGCATACCTTCCTTACTTTAGCAAAGCTAGGTTTACGAAG
ATCAGTATACAAAATTCGTATATCGTGCCAGAAAGTAGAAGGATTCCATAAGTGAAAATTGAAACAAGCGGGTAATAATCATATCTAATTTGAGTCTATCACATCATCTAGTATATCATA
TTATCTGATTTGTTAGCTCTTCCCCATTGATTTTAGGGCTGTGATGCATCCATCCTCCTAAATTCAACCAAGGGAAACACTGCCGAAAAAGATAGCCCCGTGAACAACCCTAGTTTAGAA
GGTTTCGATGTCATCGACCAAGCGAAAGCCCGGCTAGAAGCCGCATGCCCGCGAACTGTCTCGTGCGCCGACATCATCGCATTTGCGGCCCGAGACAGCGTCTTCAAGGCTGGCCGTATC
TACTATGATGTCCCCTCGGGCCGTCGTGATGGTCGCATCTCCCGCGCCTCCGAGGTGATCCAGAACCTCCCTCCCCCGACCTTCACTGTGCCGCAACTCATTGCCAACTTCGCGAGAAAA
GGGTTCTCAATGGACGAGATGGTGACCCTCTCGGGAGCACACTCCATCGGCAGCTCTCACTGCTCGTCCTTCTCGAACCGTCTGTACTCGTTCAACGCGACGCACAAGCAAGACCCGTTG
TTGGACCCTAAGTACGCGGCCTTCTTGAAGACCAAGTGCCCCCAGGGCAATTCCAAGACGGACCCGAAGGTGGCGCTCGACAGCATCACGCCAAACACTCTGGACAACAAGTACTACCAA
CAGCTACTGACTTACCGTGGGTTGTTCTCTTCCGATGAGGCGCTGTACACTAGCAAGTTGACGAAAGGGATGGTGTTGAACAACGCAAAATACGGCCGCGTGTGGGGGCCTAAGTTCGTG
AAGGCAATGGTGAAGCTGGGCTCGCTCGACGTGCTCACTGGTCAACAGGGCGAAATTAGGAAAGTTTGCGGCGCCGTGAATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCCATTCAAGCCCTGGTCGCTTCCTTCTTCCTAGTTTTTGCTGTATCTGCAACAGCTCTCCCTACGCAGGTGTACCCGTTGTCTTCGCCATCGTCCCTCAGCGTCGGATTCTAC
AAATATACATGCCCTCCTGCCGAAGCCATCGTCAGAGCCACTCTTTATGAGGCCTTTTCCAGTGATCCGGGGTTGGCTGCTGATTTCCTCCGGATGTATTTCCACGACTGCTTCGTGAGG
GGCTGTGATGCATCCATCCTCCTAAATTCAACCAAGGGAAACACTGCCGAAAAAGATAGCCCCGTGAACAACCCTAGTTTAGAAGGTTTCGATGTCATCGACCAAGCGAAAGCCCGGCTA
GAAGCCGCATGCCCGCGAACTGTCTCGTGCGCCGACATCATCGCATTTGCGGCCCGAGACAGCGTCTTCAAGGCTGGCCGTATCTACTATGATGTCCCCTCGGGCCGTCGTGATGGTCGC
ATCTCCCGCGCCTCCGAGGTGATCCAGAACCTCCCTCCCCCGACCTTCACTGTGCCGCAACTCATTGCCAACTTCGCGAGAAAAGGGTTCTCAATGGACGAGATGGTGACCCTCTCGGGA
GCACACTCCATCGGCAGCTCTCACTGCTCGTCCTTCTCGAACCGTCTGTACTCGTTCAACGCGACGCACAAGCAAGACCCGTTGTTGGACCCTAAGTACGCGGCCTTCTTGAAGACCAAG
TGCCCCCAGGGCAATTCCAAGACGGACCCGAAGGTGGCGCTCGACAGCATCACGCCAAACACTCTGGACAACAAGTACTACCAACAGCTACTGACTTACCGTGGGTTGTTCTCTTCCGAT
GAGGCGCTGTACACTAGCAAGTTGACGAAAGGGATGGTGTTGAACAACGCAAAATACGGCCGCGTGTGGGGGCCTAAGTTCGTGAAGGCAATGGTGAAGCTGGGCTCGCTCGACGTGCTC
ACTGGTCAACAGGGCGAAATTAGGAAAGTTTGCGGCGCCGTGAATTGA

Retrieve as FASTA