Entry information : EgrPrx118 (Eucgr.H00887 / Egrandis_v1_0.042298m)
Entry ID 8130
Creation 2011-02-04 (Christophe Dunand)
Last sequence changes 2011-02-08 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2013-10-30 (Qiang Li)
Peroxidase information: EgrPrx118 (Eucgr.H00887 / Egrandis_v1_0.042298m)
Name (synonym) EgrPrx118 (Eucgr.H00887 / Egrandis_v1_0.042298m)
Class Class III peroxidase    [Orthogroup: Prx090]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrPrx118
start..stop
S start..stop
EglPrx118 699 0 1..339 1..339
EguPrx118 680 0 1..339 1..339
EcamPrx119 613 0 1..339 1..338
EgrPrx119 610 0 1..339 1..338
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 11023617..11023862 246 N° 2 11024348..11025121 774  
join(11023617..11023862,11024348..11025121)


exon

Literature and cross-references EgrPrx118 (Eucgr.H00887 / Egrandis_v1_0.042298m)
DNA ref. Phytozome 12:   scaffold_8 (11023617..11025121)
Protein sequence: EgrPrx118 (Eucgr.H00887 / Egrandis_v1_0.042298m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   340 (313)
PWM (Da):   %s   36544.73 (33739.3) Transmb domain:   %s   i5-27o
PI (pH):   %s   9.51 (9.63) Peptide Signal:   %s   cut: 27 range:27-339
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MADSMFWGIAWAFVLVLAGTVPSVAAATKPCRTSSKFRVGFYKYTCPAAASIVKQTVYEAVAKNPGMAAGLLRLHFHDCFVRGCDASVLLKSTPENPAERDHPTNNPSLRGFEIIDQAKARLEAVCPKTVSCADIVAFAARDSVYKTGGIYYNVPAGRRDGRVSRLSEVTQNLPSPNFNAQQLIANFARKGLSANEMVTLLGAHSIGISHCSSFSSRLYAFNATLTQDPSLDPAFAAFLKTKCLPQSNVTRVDPTVPLDSITPGTLDNKYYLQLLKLRGVLAKDETLYTSPSTSRMVVSNAVNGAAWRAKFAKAMVKMGSLDVLTGAQGEIRELCSVVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Also found in scaffold_79 (only exon 4: Egrandis_v1_0.041788m). Correct prediction from phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGATTCGATGTTCTGGGGTATCGCATGGGCTTTCGTCCTAGTTTTGGCCGGCACCGTCCCATCTGTGGCGGCGGCTACGAAGCCATGCCGGACATCGTCCAAGTTCAGGGTCGGA
TTCTACAAGTACACCTGTCCAGCTGCGGCGTCGATCGTCAAGCAGACTGTGTATGAAGCCGTCGCCAAGAATCCCGGAATGGCGGCCGGACTCCTCCGCCTGCATTTCCACGATTGCTTT
GTTAGG
GTACATGAAACATCTCTAGCTCCTTTTGACGAGTCCTTTAATTTATAGGCTCGTTTCACTATACAAATACGCGTGCATGGCCGTGCGCATACGTACTTCAAGACACATGATACT
TGGTCAATCCCTATCCATCAGAAATTACAATATTAGTCAACACCTCGGGGTTGACACAATTGCTTGGAGGGGAAGGTATTTTCATGTCGGCAACTGAAGATCTCCTATTCAAATCCCATA
ACTTACGTACTAACTGCACCGGGTCATCTGTATAGGCCAAAGATTGGACTTTAACAGGTTTGTTGGGGGTTGTAGGGTATTCCCCGGGCTTCAAAGGCAGCAAGGCCTCTAAACTCATGC
CCTTAGTTTATAAAATGAAATTTACATAATCAAACACAAAATTTAGTTAAGTAAATTTAACAGAGTTCGAAAAATAAAACGAATTTGGTATGGCATGTTGTTTCTATCTCTAACCATTGA
ATTTTGATTAGGGTTGCGATGCTTCGGTGCTCTTGAAATCGACCCCTGAAAACCCGGCGGAGAGAGACCATCCCACCAATAACCCTAGCTTGAGAGGCTTCGAGATCATCGACCAGGCCA
AGGCCAGACTCGAGGCCGTGTGTCCCAAAACGGTCTCGTGCGCCGACATCGTTGCTTTCGCGGCCCGCGACAGCGTCTACAAAACCGGGGGCATATATTACAACGTCCCTGCTGGCCGCC
GTGATGGCCGCGTCTCTCGCCTTTCCGAAGTGACCCAAAACCTCCCGTCGCCAAACTTCAACGCCCAACAGTTGATTGCTAATTTCGCCAGGAAAGGCCTGTCGGCGAACGAGATGGTGA
CCCTCTTGGGAGCGCACTCCATCGGCATCTCGCACTGCTCGTCCTTCTCATCCCGGCTCTACGCGTTCAATGCCACACTGACCCAAGATCCTTCGTTGGATCCGGCATTCGCCGCCTTCC
TGAAGACCAAATGCCTACCCCAAAGCAACGTGACACGAGTAGACCCGACGGTGCCGCTCGACAGCATCACACCTGGCACTCTGGACAACAAGTACTACCTTCAGCTGCTGAAGCTCCGCG
GCGTGTTGGCTAAGGACGAGACACTGTACACAAGTCCCTCAACTTCGCGGATGGTTGTGAGCAACGCGGTGAATGGCGCCGCTTGGAGAGCGAAGTTCGCCAAGGCAATGGTGAAGATGG
GCTCGCTCGACGTGCTCACCGGCGCACAGGGAGAGATCAGGGAGCTGTGCAGTGTAGTGAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGATTCGATGTTCTGGGGTATCGCATGGGCTTTCGTCCTAGTTTTGGCCGGCACCGTCCCATCTGTGGCGGCGGCTACGAAGCCATGCCGGACATCGTCCAAGTTCAGGGTCGGA
TTCTACAAGTACACCTGTCCAGCTGCGGCGTCGATCGTCAAGCAGACTGTGTATGAAGCCGTCGCCAAGAATCCCGGAATGGCGGCCGGACTCCTCCGCCTGCATTTCCACGATTGCTTT
GTTAGG
GGTTGCGATGCTTCGGTGCTCTTGAAATCGACCCCTGAAAACCCGGCGGAGAGAGACCATCCCACCAATAACCCTAGCTTGAGAGGCTTCGAGATCATCGACCAGGCCAAGGCC
AGACTCGAGGCCGTGTGTCCCAAAACGGTCTCGTGCGCCGACATCGTTGCTTTCGCGGCCCGCGACAGCGTCTACAAAACCGGGGGCATATATTACAACGTCCCTGCTGGCCGCCGTGAT
GGCCGCGTCTCTCGCCTTTCCGAAGTGACCCAAAACCTCCCGTCGCCAAACTTCAACGCCCAACAGTTGATTGCTAATTTCGCCAGGAAAGGCCTGTCGGCGAACGAGATGGTGACCCTC
TTGGGAGCGCACTCCATCGGCATCTCGCACTGCTCGTCCTTCTCATCCCGGCTCTACGCGTTCAATGCCACACTGACCCAAGATCCTTCGTTGGATCCGGCATTCGCCGCCTTCCTGAAG
ACCAAATGCCTACCCCAAAGCAACGTGACACGAGTAGACCCGACGGTGCCGCTCGACAGCATCACACCTGGCACTCTGGACAACAAGTACTACCTTCAGCTGCTGAAGCTCCGCGGCGTG
TTGGCTAAGGACGAGACACTGTACACAAGTCCCTCAACTTCGCGGATGGTTGTGAGCAACGCGGTGAATGGCGCCGCTTGGAGAGCGAAGTTCGCCAAGGCAATGGTGAAGATGGGCTCG
CTCGACGTGCTCACCGGCGCACAGGGAGAGATCAGGGAGCTGTGCAGTGTAGTGAACTGA

Retrieve as FASTA