Entry information : EgrPrx130 (Eucgr.H03915 / Egrandis_v1_0.053544m)
Entry ID 8134
Creation 2011-02-04 (Christophe Dunand)
Last sequence changes 2011-02-22 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-03-09 (Qiang Li)
Peroxidase information: EgrPrx130 (Eucgr.H03915 / Egrandis_v1_0.053544m)
Name (synonym) EgrPrx130 (Eucgr.H03915 / Egrandis_v1_0.053544m)
Class Class III peroxidase    [Orthogroup: Prx074]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrPrx130
start..stop
S start..stop
EglPrx130 669 0 1..323 1..323
EcamPrx129-2 656 0 1..323 1..323
EcamPrx130 655 0 1..323 1..323
EgrPrx129 649 0 1..323 1..323
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 56899777..56899843 67 N° 2 56899519..56899661 143 N° 3 56897936..56898697 762  
complement(join(56897936..56898697,56899519..56899661,56899777..56899843))


exon

Literature and cross-references EgrPrx130 (Eucgr.H03915 / Egrandis_v1_0.053544m)
DNA ref. Phytozome 12:   scaffold_8 (56899843..56897936)
Protein sequence: EgrPrx130 (Eucgr.H03915 / Egrandis_v1_0.053544m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   324 (301)
PWM (Da):   %s   34802.65 (32435.4) Transmb domain:   %s   i7-29o
PI (pH):   %s   8.62 (8.72) Peptide Signal:   %s   cut: 23 range:23-323
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASSSAYLSFVLVICLISPAISGPLKVGFYQKKCPSAEAMVRESVQKALAADPGAVAPLIRLHFHDCFVRGCDGSILLNSTKGNTAEKDSMGNLGIGGFEVIDDAKAKIEAQCPNTVSCADIVAFAARDGVRAAGGFHYAVPSGRRDGRVSLASEVIKNLPGPFFDAVQLEANFAKKGLSLRDMVTLSGAHSIGDSHCSQFTKRLYSFNSTYSQDPSLNPNYAHLLKTKCPRNGPTDPIVPFDPVTPNVLDNAYYHNLKSDKGLLYSDQVLWDASLTRGLVKDNANHPSAWARRFTAAMVRMGLIEVLTGTQGEIRKNCRVIN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (Egrandis_v1_0.053544m, scaffold_8: 56897936 - 56899659). Incorrect prediction from phytozome (Short 5' (part of exon 1) end is missing which has been completed manually. Intron 1.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAAGCTCGAGCGCTTACTTGAGCTTTGTTTTGGTGATCTGTTTAATTTCACCTGCAATTTCAGGTCCGATTTCATTTTCCCTTATGCTAGCAGTTTCAACACGTGCGTTTGAGTTG
ATATATTGTTGATTTTCTTGTCTTGGTCATAAATTTTTGTTTTCGGTTGGGTCCAATTTCAGGTCCATTGAAGGTTGGGTTTTATCAGAAGAAATGCCCATCTGCTGAGGCCATGGTGAG
AGAGTCAGTACAGAAGGCTCTAGCTGCTGACCCTGGAGCTGTTGCTCCGCTCATTAGGCTCCATTTCCATGACTGTTTTGTCAGA
GTAATTTTCTAACTCAAGCATTTTATGTGCAACAT
CATTACAGGTGTGTTTGGTTGACGAGTTGCAAAACTTCTTGGGTAAATGCAAATACTGTTTGGCAAAATTTTTTGGGTACTTTGAGGAGATGCAATTTGCACCTTCAAAGCTCTTTAAAG
GCATTTAACACAAATTAAGTTTGGAGATACTTTAAAATATTATGTTTCCAAAATGCAAATAGACATTTTTCGTTCCAACTTTACCCTCGCTCAACTTTCATAATTCCGGAAATGTTCTTG
AAAGCCCTAATTTTTGCCTCAGCCACCAACGAGCAAGTTGGTGAGCCACTACCACTCTCAATGGTCGTGACTGAGTTCCACCAACAAATAATTTGAGATTTTTTATAAAAAAATTAGCAA
AAACCATTTACAAAGTATAATTTGTACCATACAGTATTTCTATTAAAATTGCTTTTCAACGTGTTTTTAAAATACACTTTACCGAACAGTACTTGTATTTTGAAAAATCCTTTTAACCCA
AAGGTCTATGCGTTTTCCCAAAAAATATTTTTCAAAAATCGAACTAAACACACCTTTTAAGTATTCTCTTGCGATGTCTATTACATTTGCATATTGATCCACTTTTTTTGCAAAACCCAT
ACATGGGCCAGCTTTCATTTGAATAACTAATCCTAGGAACTTAGAAGTCGGGTTTGCATGATTGATGTCACAAACTCTAAATGGATATCTAAATAAATCTGTCATAGATGTTCCTATATC
TAATTAAAAATAATCATGTAAAAATGGATATTTCTATGTTGTGACGTACGGTCTTCTAGTACTCAGGGTTGCGACGGGTCCATTCTTCTCAACTCGACCAAAGGGAACACCGCGGAGAAA
GATAGCATGGGAAACCTCGGCATCGGGGGCTTTGAGGTGATCGACGATGCCAAGGCCAAGATTGAAGCCCAATGCCCTAACACCGTCTCATGTGCCGACATTGTGGCCTTCGCCGCTCGT
GATGGTGTTCGAGCTGCCGGAGGCTTTCACTATGCCGTCCCTAGCGGGAGGCGGGATGGGAGAGTCTCGCTCGCGTCGGAGGTGATCAAAAACCTCCCCGGCCCATTTTTTGATGCTGTG
CAACTCGAAGCGAACTTTGCGAAGAAAGGGCTTTCGCTCCGAGACATGGTGACTCTCTCCGGAGCTCACTCCATCGGGGACTCTCATTGCTCCCAATTCACGAAGCGACTCTACTCCTTC
AACTCGACTTATTCACAAGATCCTTCCCTTAATCCTAATTATGCCCATCTTTTGAAGACCAAGTGCCCGCGAAACGGCCCCACCGACCCGATCGTACCATTCGATCCGGTGACGCCGAAC
GTACTCGATAATGCTTACTACCACAACTTAAAGAGTGACAAGGGATTGTTGTATTCGGACCAAGTGCTGTGGGATGCGTCATTGACAAGGGGGTTAGTGAAGGACAATGCGAACCACCCC
AGCGCTTGGGCTCGGAGGTTTACGGCCGCGATGGTGCGCATGGGTTTGATCGAGGTGCTCACTGGCACGCAAGGAGAAATTAGGAAGAATTGCAGGGTGATAAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAAGCTCGAGCGCTTACTTGAGCTTTGTTTTGGTGATCTGTTTAATTTCACCTGCAATTTCAGGTCCATTGAAGGTTGGGTTTTATCAGAAGAAATGCCCATCTGCTGAGGCCATG
GTGAGAGAGTCAGTACAGAAGGCTCTAGCTGCTGACCCTGGAGCTGTTGCTCCGCTCATTAGGCTCCATTTCCATGACTGTTTTGTCAGA
GGTTGCGACGGGTCCATTCTTCTCAACTCG
ACCAAAGGGAACACCGCGGAGAAAGATAGCATGGGAAACCTCGGCATCGGGGGCTTTGAGGTGATCGACGATGCCAAGGCCAAGATTGAAGCCCAATGCCCTAACACCGTCTCATGTGCC
GACATTGTGGCCTTCGCCGCTCGTGATGGTGTTCGAGCTGCCGGAGGCTTTCACTATGCCGTCCCTAGCGGGAGGCGGGATGGGAGAGTCTCGCTCGCGTCGGAGGTGATCAAAAACCTC
CCCGGCCCATTTTTTGATGCTGTGCAACTCGAAGCGAACTTTGCGAAGAAAGGGCTTTCGCTCCGAGACATGGTGACTCTCTCCGGAGCTCACTCCATCGGGGACTCTCATTGCTCCCAA
TTCACGAAGCGACTCTACTCCTTCAACTCGACTTATTCACAAGATCCTTCCCTTAATCCTAATTATGCCCATCTTTTGAAGACCAAGTGCCCGCGAAACGGCCCCACCGACCCGATCGTA
CCATTCGATCCGGTGACGCCGAACGTACTCGATAATGCTTACTACCACAACTTAAAGAGTGACAAGGGATTGTTGTATTCGGACCAAGTGCTGTGGGATGCGTCATTGACAAGGGGGTTA
GTGAAGGACAATGCGAACCACCCCAGCGCTTGGGCTCGGAGGTTTACGGCCGCGATGGTGCGCATGGGTTTGATCGAGGTGCTCACTGGCACGCAAGGAGAAATTAGGAAGAATTGCAGG
GTGATAAATTAA

Retrieve as FASTA